BLASTX nr result
ID: Zingiber23_contig00036424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036424 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006412451.1| hypothetical protein EUTSA_v10025242mg [Eutr... 76 5e-12 ref|XP_006283708.1| hypothetical protein CARUB_v10004779mg [Caps... 76 5e-12 ref|XP_002869261.1| hypothetical protein ARALYDRAFT_328473 [Arab... 76 5e-12 ref|NP_194986.2| C3H4 type zinc finger protein [Arabidopsis thal... 76 5e-12 emb|CAA18601.1| putative protein [Arabidopsis thaliana] gi|72701... 76 5e-12 ref|XP_006648026.1| PREDICTED: E3 ubiquitin-protein ligase At1g1... 75 7e-12 ref|XP_002284536.2| PREDICTED: E3 ubiquitin-protein ligase At4g1... 75 1e-11 emb|CBI20932.3| unnamed protein product [Vitis vinifera] 75 1e-11 dbj|BAD19217.1| RING zinc finger protein-like [Oryza sativa Japo... 74 2e-11 gb|EAY87799.1| hypothetical protein OsI_09219 [Oryza sativa Indi... 74 2e-11 ref|NP_001048342.1| Os02g0787500 [Oryza sativa Japonica Group] g... 74 2e-11 gb|EMT29820.1| E3 ubiquitin-protein ligase [Aegilops tauschii] 74 2e-11 ref|XP_004138872.1| PREDICTED: E3 ubiquitin-protein ligase At4g1... 74 2e-11 ref|XP_003568812.1| PREDICTED: E3 ubiquitin-protein ligase At4g1... 74 3e-11 dbj|BAJ95361.1| predicted protein [Hordeum vulgare subsp. vulgare] 74 3e-11 ref|XP_002516614.1| ring finger protein, putative [Ricinus commu... 74 3e-11 ref|XP_006660535.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 73 3e-11 ref|XP_002309588.2| zinc finger family protein [Populus trichoca... 73 3e-11 ref|XP_004959371.1| PREDICTED: uncharacterized protein LOC101782... 73 3e-11 ref|XP_004291419.1| PREDICTED: E3 ubiquitin-protein ligase At4g1... 73 3e-11 >ref|XP_006412451.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum] gi|557113621|gb|ESQ53904.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum] Length = 435 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLS 350 +ELRELPC+HFFHKECVDKWLK+NA CPLCK+ G NS L+ Sbjct: 362 EELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLT 403 >ref|XP_006283708.1| hypothetical protein CARUB_v10004779mg [Capsella rubella] gi|482552413|gb|EOA16606.1| hypothetical protein CARUB_v10004779mg [Capsella rubella] Length = 454 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLS 350 +ELRELPC+HFFHKECVDKWLK+NA CPLCK+ G NS L+ Sbjct: 373 EELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLT 414 >ref|XP_002869261.1| hypothetical protein ARALYDRAFT_328473 [Arabidopsis lyrata subsp. lyrata] gi|297315097|gb|EFH45520.1| hypothetical protein ARALYDRAFT_328473 [Arabidopsis lyrata subsp. lyrata] Length = 489 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLS 350 +ELRELPC+HFFHKECVDKWLK+NA CPLCK+ G NS L+ Sbjct: 374 EELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLT 415 >ref|NP_194986.2| C3H4 type zinc finger protein [Arabidopsis thaliana] gi|18377636|gb|AAL66968.1| unknown protein [Arabidopsis thaliana] gi|19698907|gb|AAL91189.1| putative protein [Arabidopsis thaliana] gi|20465641|gb|AAM20289.1| unknown protein [Arabidopsis thaliana] gi|332660687|gb|AEE86087.1| C3H4 type zinc finger protein [Arabidopsis thaliana] Length = 453 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLS 350 +ELRELPC+HFFHKECVDKWLK+NA CPLCK+ G NS L+ Sbjct: 374 EELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLT 415 >emb|CAA18601.1| putative protein [Arabidopsis thaliana] gi|7270164|emb|CAB79977.1| putative protein [Arabidopsis thaliana] Length = 495 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLS 350 +ELRELPC+HFFHKECVDKWLK+NA CPLCK+ G NS L+ Sbjct: 374 EELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLT 415 >ref|XP_006648026.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Oryza brachyantha] Length = 399 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLSDTATP 335 DELRELPCTH FHKECVDKWLK+NALCPLCK+ ++S SDT P Sbjct: 341 DELRELPCTHCFHKECVDKWLKINALCPLCKSEIA-SSSGTSDTRRP 386 >ref|XP_002284536.2| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Vitis vinifera] Length = 421 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHKECVDKWLK+NALCPLCK G Sbjct: 374 DELRELPCSHFFHKECVDKWLKINALCPLCKREVG 408 >emb|CBI20932.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHKECVDKWLK+NALCPLCK G Sbjct: 354 DELRELPCSHFFHKECVDKWLKINALCPLCKREVG 388 >dbj|BAD19217.1| RING zinc finger protein-like [Oryza sativa Japonica Group] gi|47497754|dbj|BAD19854.1| RING zinc finger protein-like [Oryza sativa Japonica Group] gi|215694772|dbj|BAG89963.1| unnamed protein product [Oryza sativa Japonica Group] Length = 199 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLSDTATPIH 329 DELRELPCTH FHKECVDKWLK+NALCPLCK+ ++S SDT H Sbjct: 141 DELRELPCTHCFHKECVDKWLKINALCPLCKSEIA-SSSGTSDTRRSDH 188 >gb|EAY87799.1| hypothetical protein OsI_09219 [Oryza sativa Indica Group] gi|125583947|gb|EAZ24878.1| hypothetical protein OsJ_08658 [Oryza sativa Japonica Group] Length = 398 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLSDTATPIH 329 DELRELPCTH FHKECVDKWLK+NALCPLCK+ ++S SDT H Sbjct: 340 DELRELPCTHCFHKECVDKWLKINALCPLCKSEIA-SSSGTSDTRRSDH 387 >ref|NP_001048342.1| Os02g0787500 [Oryza sativa Japonica Group] gi|113537873|dbj|BAF10256.1| Os02g0787500, partial [Oryza sativa Japonica Group] Length = 342 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLSDTATPIH 329 DELRELPCTH FHKECVDKWLK+NALCPLCK+ ++S SDT H Sbjct: 284 DELRELPCTHCFHKECVDKWLKINALCPLCKSEIA-SSSGTSDTRRSDH 331 >gb|EMT29820.1| E3 ubiquitin-protein ligase [Aegilops tauschii] Length = 609 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAGITNSQLSDTATPIHHSGGLPEV 305 +ELRELPCTH FHKECVDKWLK+NALCPLCK A I +S + I H+ P+V Sbjct: 341 EELRELPCTHCFHKECVDKWLKINALCPLCK--AEIASSSGTSDTRHIDHTRWCPKV 395 >ref|XP_004138872.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis sativus] gi|449499624|ref|XP_004160867.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis sativus] Length = 424 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHK+CVDKWLK+NALCPLCK G Sbjct: 374 DELRELPCSHFFHKDCVDKWLKINALCPLCKAEVG 408 >ref|XP_003568812.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Brachypodium distachyon] Length = 419 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCK 383 D+LRELPCTHFFHKECVDKWLK+NALCPLCK Sbjct: 357 DDLRELPCTHFFHKECVDKWLKINALCPLCK 387 >dbj|BAJ95361.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 420 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCK 383 D+LRELPCTHFFHKECVDKWLK+NALCPLCK Sbjct: 358 DDLRELPCTHFFHKECVDKWLKINALCPLCK 388 >ref|XP_002516614.1| ring finger protein, putative [Ricinus communis] gi|223544434|gb|EEF45955.1| ring finger protein, putative [Ricinus communis] Length = 437 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHK+CVDKWLK+NA CPLCKT G Sbjct: 373 DELRELPCSHFFHKDCVDKWLKINASCPLCKTEVG 407 >ref|XP_006660535.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Oryza brachyantha] Length = 414 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPCTHFFH +CVDKWLK+NA+CPLCKT G Sbjct: 349 DELRELPCTHFFHVQCVDKWLKINAVCPLCKTEIG 383 >ref|XP_002309588.2| zinc finger family protein [Populus trichocarpa] gi|550337127|gb|EEE93111.2| zinc finger family protein [Populus trichocarpa] Length = 429 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHKECVDKWLK+NA CPLCK+ G Sbjct: 370 DELRELPCSHFFHKECVDKWLKINASCPLCKSEVG 404 >ref|XP_004959371.1| PREDICTED: uncharacterized protein LOC101782496 [Setaria italica] Length = 373 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPCTHFFH +CVDKWLK+NA+CPLCKT G Sbjct: 308 DELRELPCTHFFHVQCVDKWLKINAVCPLCKTEIG 342 >ref|XP_004291419.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Fragaria vesca subsp. vesca] Length = 430 Score = 73.2 bits (178), Expect = 3e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 475 DELRELPCTHFFHKECVDKWLKLNALCPLCKTAAG 371 DELRELPC+HFFHKECVDKWLK+NA CPLCK+ G Sbjct: 364 DELRELPCSHFFHKECVDKWLKINASCPLCKSEVG 398