BLASTX nr result
ID: Zingiber23_contig00036381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036381 (754 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324883.2| hypothetical protein POPTR_0018s02120g [Popu... 52 3e-06 ref|XP_006382088.1| hypothetical protein POPTR_0006s27450g [Popu... 52 4e-06 gb|EMJ26708.1| hypothetical protein PRUPE_ppa000461mg [Prunus pe... 52 5e-06 gb|EOY29416.1| Octicosapeptide/Phox/Bem1p (PB1) domain-containin... 51 7e-06 >ref|XP_002324883.2| hypothetical protein POPTR_0018s02120g [Populus trichocarpa] gi|550317853|gb|EEF03448.2| hypothetical protein POPTR_0018s02120g [Populus trichocarpa] Length = 699 Score = 52.0 bits (123), Expect(2) = 3e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +1 Query: 226 IYDDKKWMIDAPSIRREPLFRRRIPKLHSMLE 321 +YD K+W I PS R EPLFRRR+PKLH MLE Sbjct: 666 MYDAKRWEIGVPSFRLEPLFRRRVPKLHDMLE 697 Score = 25.8 bits (55), Expect(2) = 3e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 186 GLAFKIDEIVQAFH 227 GL FKIDEIVQA++ Sbjct: 651 GLGFKIDEIVQAWN 664 >ref|XP_006382088.1| hypothetical protein POPTR_0006s27450g [Populus trichocarpa] gi|550337197|gb|ERP59885.1| hypothetical protein POPTR_0006s27450g [Populus trichocarpa] Length = 728 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +1 Query: 226 IYDDKKWMIDAPSIRREPLFRRRIPKLHSMLE 321 +YD K+W I PS R EPLFRRR+PKLH MLE Sbjct: 695 MYDAKRWEIGVPSFRLEPLFRRRVPKLHDMLE 726 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 186 GLAFKIDEIVQAFH 227 GL FK+DEIVQA++ Sbjct: 680 GLGFKVDEIVQAWN 693 >gb|EMJ26708.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica] Length = 1155 Score = 51.6 bits (122), Expect(2) = 5e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +1 Query: 226 IYDDKKWMIDAPSIRREPLFRRRIPKLHSMLESA 327 +YD K+W PS R EPL RRR+PKLHSMLE A Sbjct: 1122 MYDAKRWQFGVPSFRLEPLLRRRVPKLHSMLEHA 1155 Score = 25.4 bits (54), Expect(2) = 5e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 186 GLAFKIDEIVQAFH 227 GL FKIDEI+QA++ Sbjct: 1107 GLGFKIDEIIQAWN 1120 >gb|EOY29416.1| Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein [Theobroma cacao] Length = 723 Score = 50.8 bits (120), Expect(2) = 7e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +1 Query: 226 IYDDKKWMIDAPSIRREPLFRRRIPKLHSMLE 321 +YD K+W I PS R EPLFRRR PKLHS+LE Sbjct: 690 MYDVKRWQIGVPSFRLEPLFRRRAPKLHSVLE 721 Score = 25.8 bits (55), Expect(2) = 7e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 186 GLAFKIDEIVQAFH 227 GL FKIDEIVQA++ Sbjct: 675 GLGFKIDEIVQAWN 688