BLASTX nr result
ID: Zingiber23_contig00036031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036031 (434 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ96156.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 ref|XP_003566188.1| PREDICTED: beta-amylase 1, chloroplastic-lik... 55 1e-05 >dbj|BAJ96156.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 547 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 295 EVQYAHPPPP-RSGEGAPVFVTLPHDAVGLSGKMARKKTMWASLLAL 432 E+ Y PPPP + GAPV+VTLP DAVG G++AR++ M ASL AL Sbjct: 67 EIHYVSPPPPPATPSGAPVYVTLPADAVGAGGRVARRRAMAASLAAL 113 >ref|XP_003566188.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon] Length = 556 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 295 EVQYAHPPPPRSGE-GAPVFVTLPHDAVGLSGKMARKKTMWASLLAL 432 E+ Y PPPP + GAPV+VTLP DAVG G++AR++ M ASL AL Sbjct: 76 EIHYVSPPPPPAAPPGAPVYVTLPADAVGSGGRVARRRAMAASLAAL 122