BLASTX nr result
ID: Zingiber23_contig00035599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00035599 (734 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29562.1| hypothetical protein L484_010621 [Morus notabilis] 58 4e-06 >gb|EXB29562.1| hypothetical protein L484_010621 [Morus notabilis] Length = 1745 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/60 (43%), Positives = 41/60 (68%) Frame = +3 Query: 6 KKHTILYDDGDVEVLLLSKEKWEIINNTLSAGKQPKSLPALVSKNLSSSEAKKKGSTTKR 185 KKH +LYDDGDVEVL L KE+WE+I+N+ K+ + + +K++S + K GS+ ++ Sbjct: 1359 KKHVVLYDDGDVEVLRLEKERWEVIDNSRKPVKKVNTSKSSPAKDISPGKTKNFGSSGQK 1418