BLASTX nr result
ID: Zingiber23_contig00035375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00035375 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata ... 87 3e-15 >gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata subsp. malaccensis] Length = 1442 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = +1 Query: 73 CEQLSWVPVKRLKELTSLWSLSIKECPKLMSMSTPDEYIDFQLPPSITELCLSDCGNLSK 252 C +L W+PVKR +E T+L +LSI+ CPKLMSM+ +E D LPPSI L L DCGNL K Sbjct: 1167 CAELLWLPVKRFREFTTLENLSIRNCPKLMSMTQCEEN-DLLLPPSIKALELGDCGNLGK 1225 Query: 253 SLPGCLH 273 SLPGCLH Sbjct: 1226 SLPGCLH 1232