BLASTX nr result
ID: Zingiber23_contig00033115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00033115 (661 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE81277.1| hypothetical protein [Cacao swollen shoot virus] 64 4e-08 ref|NP_041732.1| hypothetical protein CSSVgp1 [Cacao swollen sho... 63 7e-08 emb|CAE81283.1| hypothetical protein [Cacao swollen shoot virus] 63 7e-08 emb|CAE76626.1| hypothetical protein [Cacao swollen shoot virus] 63 7e-08 emb|CAG70340.1| hypothetical protein [Cacao swollen shoot virus] 63 7e-08 emb|CAD59230.1| hypothetical protein [Cacao swollen shoot virus] 63 7e-08 ref|YP_009002583.1| hypothetical protein [Hibiscus bacilliform v... 63 9e-08 gb|ACO55656.1| unknown [Citrus yellow mosaic virus] 61 3e-07 ref|NP_569151.1| hypothetical protein CYMVgp1 [Citrus yellow mos... 61 3e-07 gb|AER00542.1| ORF I [Citrus yellow mosaic virus] 61 3e-07 gb|AER00536.1| ORF I [Citrus yellow mosaic virus] 61 3e-07 gb|ACE76862.1| unknown [Citrus yellow mosaic virus] 61 3e-07 gb|ACE76856.1| unknown [Citrus yellow mosaic virus] 61 3e-07 gb|ACE74696.1| unknown [Citrus yellow mosaic virus] gi|198385719... 61 3e-07 gb|ACB87154.1| unknown [Citrus yellow mosaic virus] 61 3e-07 gb|ACB87148.1| unknown [Citrus yellow mosaic virus] 61 3e-07 gb|AFM82588.1| hypothetical protein [Cacao swollen shoot virus] 60 4e-07 ref|XP_006858540.1| hypothetical protein AMTR_s00071p00160380 [A... 59 1e-06 ref|YP_006273073.1| hypothetical protein [Fig badnavirus 1] gi|3... 57 4e-06 >emb|CAE81277.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE++I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWEDSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >ref|NP_041732.1| hypothetical protein CSSVgp1 [Cacao swollen shoot virus] gi|347869|gb|AAA03169.1| ORF1 [Cacao swollen shoot virus] Length = 143 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWENSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >emb|CAE81283.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWENSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >emb|CAE76626.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWENSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >emb|CAG70340.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWESSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >emb|CAD59230.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+T K ++ +LAHN+++ Sbjct: 1 MSSRWENSIQEWYEKSHTANLEYLDLASTSKVTNNQLAHNLAV 43 >ref|YP_009002583.1| hypothetical protein [Hibiscus bacilliform virus GD1] gi|584388571|gb|AHI90952.1| hypothetical protein [Hibiscus bacilliform virus GD1] Length = 143 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWEE I+ WY S TS+LEYLDLA+T K S+++LAHN+S+ Sbjct: 1 MSRRWEEEIQKWYEQSSTSSLEYLDLASTSKVSNQQLAHNLSV 43 >gb|ACO55656.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQKWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >ref|NP_569151.1| hypothetical protein CYMVgp1 [Citrus yellow mosaic virus] gi|16416937|gb|AAL18493.1|AF347695_1 unknown [citrus yellow mosaic virus] Length = 143 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQKWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|AER00542.1| ORF I [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|AER00536.1| ORF I [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|ACE76862.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|ACE76856.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|ACE74696.1| unknown [Citrus yellow mosaic virus] gi|198385719|gb|ACH86205.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|ACB87154.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|ACB87148.1| unknown [Citrus yellow mosaic virus] Length = 143 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS WEEAI+ WY +SHT+NLEYLDLA+ K S+ E++HN+++ Sbjct: 1 MSRIWEEAIQRWYETSHTANLEYLDLASKPKVSNSEISHNLAV 43 >gb|AFM82588.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS RWE +I+ WY SHT+NLEYLDLA+ K ++ ++AHN+++ Sbjct: 1 MSSRWENSIQEWYEKSHTANLEYLDLASVSKVTNNQIAHNLAV 43 >ref|XP_006858540.1| hypothetical protein AMTR_s00071p00160380 [Amborella trichopoda] gi|548862649|gb|ERN20007.1| hypothetical protein AMTR_s00071p00160380 [Amborella trichopoda] Length = 899 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MS+R+E+AI+ WY S T+NLEYLDLANT K + +LAHN+ + Sbjct: 1 MSQRYEQAIQKWYDHSRTANLEYLDLANTPKPTGSDLAHNLEV 43 >ref|YP_006273073.1| hypothetical protein [Fig badnavirus 1] gi|333493963|gb|AEF56562.1| hypothetical protein [Fig badnavirus 1] Length = 143 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = +3 Query: 531 MSERWEEAIRSWYASSHTSNLEYLDLANTEKSSHKELAHNISI 659 MSE+WE +I+ WY +S T+NLEYLDLA EK ++ L HN+++ Sbjct: 1 MSEKWERSIQDWYNNSRTANLEYLDLAEKEKPTNSHLYHNLAV 43