BLASTX nr result
ID: Zingiber23_contig00032804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032804 (238 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW58657.1| putative leucine-rich repeat transmembrane protei... 59 9e-07 ref|XP_002446698.1| hypothetical protein SORBIDRAFT_06g020750 [S... 58 1e-06 tpg|DAA37241.1| TPA: putative leucine-rich repeat transmembrane ... 56 4e-06 ref|XP_004978090.1| PREDICTED: probable inactive receptor kinase... 55 1e-05 >gb|AFW58657.1| putative leucine-rich repeat transmembrane protein kinase family protein [Zea mays] Length = 632 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 236 LIQLDLSGNRLSGPIPASLGERFASSSFNGNDGLCGRPV 120 L LDLSGN+LSG IP LG+RF SF+GN GLCGRPV Sbjct: 180 LKSLDLSGNQLSGQIPPQLGDRFPRDSFSGNSGLCGRPV 218 >ref|XP_002446698.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor] gi|241937881|gb|EES11026.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor] Length = 627 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 227 LDLSGNRLSGPIPASLGERFASSSFNGNDGLCGRPV 120 LDLSGNRL G IP+ LG+ F+ SF+GN GLCGRPV Sbjct: 184 LDLSGNRLDGQIPSQLGDNFSKDSFSGNSGLCGRPV 219 >tpg|DAA37241.1| TPA: putative leucine-rich repeat transmembrane protein kinase family protein [Zea mays] Length = 626 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 236 LIQLDLSGNRLSGPIPASLGERFASSSFNGNDGLCGRPV 120 L LDLSGN+L G IP+ LG+ F SF+GN GLCGRPV Sbjct: 180 LKSLDLSGNKLDGQIPSQLGDNFPMDSFSGNSGLCGRPV 218 >ref|XP_004978090.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Setaria italica] Length = 650 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 236 LIQLDLSGNRLSGPIPASLGERFASSSFNGNDGLCGRPV 120 L LDLSGNRLSG IP LG F+ +F+GN GLCG PV Sbjct: 199 LKSLDLSGNRLSGQIPPQLGANFSKDAFSGNSGLCGHPV 237