BLASTX nr result
ID: Zingiber23_contig00032130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032130 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05854.1| hypothetical protein PRUPE_ppa001501mg [Prunus pe... 55 1e-05 gb|EMJ04225.1| hypothetical protein PRUPE_ppa018734mg [Prunus pe... 55 1e-05 >gb|EMJ05854.1| hypothetical protein PRUPE_ppa001501mg [Prunus persica] Length = 813 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -1 Query: 131 EVIGRELEKNKIVNMLTK--DDNESSHGTLKVITIVGMGGLGKTT 3 +VIGRE EK +I+N+L + DDN+S +G + VI IVG+GGLGKTT Sbjct: 169 KVIGRESEKKQIINLLMEQGDDNQSGNGNVSVIPIVGIGGLGKTT 213 >gb|EMJ04225.1| hypothetical protein PRUPE_ppa018734mg [Prunus persica] Length = 835 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -1 Query: 131 EVIGRELEKNKIVNMLTK--DDNESSHGTLKVITIVGMGGLGKTT 3 +VIGRE EK +I+N+L + DDN+S +G + VI IVG+GGLGKTT Sbjct: 169 KVIGRESEKKQIINLLMEQGDDNQSGNGNVSVIPIVGIGGLGKTT 213