BLASTX nr result
ID: Zingiber23_contig00032051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032051 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308497.1| hypothetical protein POPTR_0006s23270g [Popu... 56 6e-06 >ref|XP_002308497.1| hypothetical protein POPTR_0006s23270g [Populus trichocarpa] gi|222854473|gb|EEE92020.1| hypothetical protein POPTR_0006s23270g [Populus trichocarpa] Length = 276 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/38 (52%), Positives = 30/38 (78%) Frame = -3 Query: 410 LGWLRRRHTCPCCRHELPTENVACEMGRMWRAAVRSGN 297 L WL++ +TCPCCR +LPTE+V CE+ R+W A ++ G+ Sbjct: 231 LPWLKKTNTCPCCRFQLPTEDVFCEIERLWSALIKIGD 268