BLASTX nr result
ID: Zingiber23_contig00032021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032021 (227 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma ca... 107 2e-21 sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; ... 105 5e-21 gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus... 105 5e-21 ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citr... 105 5e-21 ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [C... 105 5e-21 ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arieti... 105 5e-21 ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [G... 105 5e-21 ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycin... 105 5e-21 ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycin... 105 5e-21 ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus... 105 5e-21 ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus... 105 5e-21 gb|ABK93207.1| unknown [Populus trichocarpa] 105 5e-21 ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocar... 105 5e-21 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] 105 6e-21 ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [G... 104 1e-20 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus... 104 1e-20 ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citr... 104 1e-20 ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [A... 104 1e-20 ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [A... 104 1e-20 ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11-like [F... 104 1e-20 >gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao] Length = 257 Score = 107 bits (267), Expect = 2e-21 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = +2 Query: 44 ILLSAMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYT 223 +L AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYT Sbjct: 71 LLHFAMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYT 130 Query: 224 V 226 V Sbjct: 131 V 131 >sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 gi|463252|emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina] gi|568829354|ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis] gi|557549431|gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina] Length = 182 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum] gi|502156356|ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|502158502|ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|24817256|emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max] gi|356517806|ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|571462385|ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|571520870|ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|255627231|gb|ACU13960.1| unknown [Glycine max] gi|255648308|gb|ACU24606.1| unknown [Glycine max] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max] gi|255626957|gb|ACU13823.1| unknown [Glycine max] Length = 181 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTV 56 >ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223551092|gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223538487|gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >gb|ABK93207.1| unknown [Populus trichocarpa] Length = 180 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa] gi|224091827|ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa] gi|224116812|ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa] gi|224116816|ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa] gi|118483608|gb|ABK93699.1| unknown [Populus trichocarpa] gi|222855337|gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa] gi|222855338|gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa] gi|222860465|gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa] gi|222860466|gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa] Length = 180 Score = 105 bits (263), Expect = 5e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] Length = 181 Score = 105 bits (262), Expect = 6e-21 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTV 56 >ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris] Length = 181 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MA+EKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina] gi|568826525|ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis] gi|557552144|gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina] Length = 182 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MAS+KKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda] gi|548854636|gb|ERN12546.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda] Length = 183 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda] gi|548846056|gb|ERN05363.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda] Length = 183 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56 >ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11-like [Fragaria vesca subsp. vesca] Length = 181 Score = 104 bits (260), Expect = 1e-20 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 59 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQIPVFSKARYTV 226 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTV Sbjct: 1 MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV 56