BLASTX nr result
ID: Zingiber23_contig00031948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031948 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006832836.1| hypothetical protein AMTR_s00095p00033450 [A... 56 4e-06 >ref|XP_006832836.1| hypothetical protein AMTR_s00095p00033450 [Amborella trichopoda] gi|548837336|gb|ERM98114.1| hypothetical protein AMTR_s00095p00033450 [Amborella trichopoda] Length = 636 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 108 LMGPEEELSLDYKLVPWSSWDQWNFVRECIFSSSP 4 ++ E++LS YKLVPW SWDQWNFVRE + SSSP Sbjct: 9 ILEEEKDLSYGYKLVPWQSWDQWNFVREKLLSSSP 43