BLASTX nr result
ID: Zingiber23_contig00031380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031380 (200 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468132.1| PREDICTED: U2 small nuclear ribonucleoprotei... 57 3e-06 ref|XP_006431967.1| hypothetical protein CICLE_v10002361mg [Citr... 57 3e-06 ref|XP_006431966.1| hypothetical protein CICLE_v10002361mg [Citr... 57 3e-06 ref|XP_006431965.1| hypothetical protein CICLE_v10002361mg [Citr... 57 3e-06 ref|XP_004294757.1| PREDICTED: U2 small nuclear ribonucleoprotei... 55 1e-05 >ref|XP_006468132.1| PREDICTED: U2 small nuclear ribonucleoprotein B'' 2-like [Citrus sinensis] Length = 231 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 198 YDKPMRIQYAKSKSDCVAKEDGTFVP 121 YDKPMRIQYAKSKSDCVAKEDG+FVP Sbjct: 78 YDKPMRIQYAKSKSDCVAKEDGSFVP 103 >ref|XP_006431967.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] gi|557534089|gb|ESR45207.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] Length = 194 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 198 YDKPMRIQYAKSKSDCVAKEDGTFVP 121 YDKPMRIQYAKSKSDC+AKEDG+FVP Sbjct: 78 YDKPMRIQYAKSKSDCIAKEDGSFVP 103 >ref|XP_006431966.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] gi|557534088|gb|ESR45206.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] Length = 220 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 198 YDKPMRIQYAKSKSDCVAKEDGTFVP 121 YDKPMRIQYAKSKSDC+AKEDG+FVP Sbjct: 67 YDKPMRIQYAKSKSDCIAKEDGSFVP 92 >ref|XP_006431965.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] gi|557534087|gb|ESR45205.1| hypothetical protein CICLE_v10002361mg [Citrus clementina] Length = 231 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 198 YDKPMRIQYAKSKSDCVAKEDGTFVP 121 YDKPMRIQYAKSKSDC+AKEDG+FVP Sbjct: 78 YDKPMRIQYAKSKSDCIAKEDGSFVP 103 >ref|XP_004294757.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Fragaria vesca subsp. vesca] Length = 233 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/62 (46%), Positives = 34/62 (54%) Frame = -3 Query: 198 YDKPMRIQYAKSKSDCVAKEDGTFVPXXXXXXXXXXXXXXXXXXXXXXQSAQTNGGMPSS 19 YDKPMRIQYAK+KSDC+AKE+G+FVP QSA NGG + Sbjct: 78 YDKPMRIQYAKTKSDCIAKEEGSFVPRDKKRKQEERAADRKRRTEEGPQSAPANGGATEN 137 Query: 18 QV 13 V Sbjct: 138 GV 139