BLASTX nr result
ID: Zingiber23_contig00031351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031351 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC67457.1| efflux carrier, pin2 [Brassica juncea] 110 2e-22 ref|XP_006390822.1| hypothetical protein EUTSA_v10018257mg [Eutr... 110 2e-22 ref|XP_006300840.1| hypothetical protein CARUB_v10019932mg [Caps... 110 2e-22 emb|CAC67688.1| efflux carrier, pin3 [Brassica juncea] 110 2e-22 emb|CAC24691.1| efflux carrier of polar auxin transport [Brassic... 110 2e-22 ref|NP_177250.1| auxin efflux carrier component 3 [Arabidopsis t... 110 2e-22 gb|AEJ76925.1| auxin transport protein [Capsella bursa-pastoris] 110 2e-22 ref|XP_002887338.1| predicted protein [Arabidopsis lyrata subsp.... 110 2e-22 ref|XP_006398529.1| hypothetical protein EUTSA_v10000822mg [Eutr... 109 3e-22 ref|XP_004961133.1| PREDICTED: putative auxin efflux carrier com... 109 3e-22 gb|AAM55297.1| auxin efflux carrier protein [Medicago truncatula] 109 3e-22 ref|XP_006416127.1| hypothetical protein EUTSA_v10007111mg [Eutr... 109 4e-22 ref|XP_006307013.1| hypothetical protein CARUB_v10008599mg [Caps... 109 4e-22 gb|EMS59069.1| putative auxin efflux carrier component 3a [Triti... 109 4e-22 gb|AAC00611.1| unknown protein [Arabidopsis thaliana] 109 4e-22 ref|NP_564189.1| auxin efflux carrier component 7 [Arabidopsis t... 109 4e-22 ref|NP_849700.1| auxin efflux carrier component 7 [Arabidopsis t... 109 4e-22 gb|AFJ03880.1| auxin transport protein [Capsella bursa-pastoris] 109 4e-22 ref|XP_002893260.1| pin-formed 7 [Arabidopsis lyrata subsp. lyra... 109 4e-22 ref|NP_001077584.1| auxin efflux carrier component 7 [Arabidopsi... 109 4e-22 >emb|CAC67457.1| efflux carrier, pin2 [Brassica juncea] Length = 640 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_006390822.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum] gi|557087256|gb|ESQ28108.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum] Length = 642 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_006300840.1| hypothetical protein CARUB_v10019932mg [Capsella rubella] gi|482569550|gb|EOA33738.1| hypothetical protein CARUB_v10019932mg [Capsella rubella] Length = 648 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >emb|CAC67688.1| efflux carrier, pin3 [Brassica juncea] Length = 635 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >emb|CAC24691.1| efflux carrier of polar auxin transport [Brassica juncea] Length = 639 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|NP_177250.1| auxin efflux carrier component 3 [Arabidopsis thaliana] gi|42558887|sp|Q9S7Z8.1|PIN3_ARATH RecName: Full=Auxin efflux carrier component 3; Short=AtPIN3 gi|5817301|gb|AAD52695.1|AF087818_1 auxin transport protein [Arabidopsis thaliana] gi|5902405|gb|AAD55507.1|AC008148_17 auxin transport protein [Arabidopsis thaliana] gi|22530978|gb|AAM96993.1| putative auxin transport protein REH1 [Arabidopsis thaliana] gi|25083625|gb|AAN72096.1| putative auxin transport protein REH1 [Arabidopsis thaliana] gi|110742072|dbj|BAE98967.1| auxin transport like protein [Arabidopsis thaliana] gi|332197019|gb|AEE35140.1| auxin efflux carrier component 3 [Arabidopsis thaliana] Length = 640 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >gb|AEJ76925.1| auxin transport protein [Capsella bursa-pastoris] Length = 649 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_002887338.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333179|gb|EFH63597.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 642 Score = 110 bits (275), Expect = 2e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_006398529.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum] gi|557099618|gb|ESQ39982.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum] Length = 609 Score = 109 bits (273), Expect = 3e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AVVPLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_004961133.1| PREDICTED: putative auxin efflux carrier component 3b-like [Setaria italica] Length = 586 Score = 109 bits (273), Expect = 3e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MISWHDLYTVL AVVPLYVAMILAYGSVRWWG+ +PDQCSGINRFVA+FAVPLL Sbjct: 1 MISWHDLYTVLCAVVPLYVAMILAYGSVRWWGVLTPDQCSGINRFVAVFAVPLL 54 >gb|AAM55297.1| auxin efflux carrier protein [Medicago truncatula] Length = 659 Score = 109 bits (273), Expect = 3e-22 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AVVPLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_006416127.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum] gi|557093898|gb|ESQ34480.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum] Length = 610 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_006307013.1| hypothetical protein CARUB_v10008599mg [Capsella rubella] gi|482575724|gb|EOA39911.1| hypothetical protein CARUB_v10008599mg [Capsella rubella] Length = 618 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >gb|EMS59069.1| putative auxin efflux carrier component 3a [Triticum urartu] Length = 636 Score = 109 bits (272), Expect = 4e-22 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MIS HDLYTVLAAVVPLYVAMILAYGSVRWWGIF+PDQCSGINRFVAIFAVPLL Sbjct: 1 MISLHDLYTVLAAVVPLYVAMILAYGSVRWWGIFTPDQCSGINRFVAIFAVPLL 54 >gb|AAC00611.1| unknown protein [Arabidopsis thaliana] Length = 574 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|NP_564189.1| auxin efflux carrier component 7 [Arabidopsis thaliana] gi|15450509|gb|AAK96547.1| At1g23080/T26J12_14 [Arabidopsis thaliana] gi|332192212|gb|AEE30333.1| auxin efflux carrier component 7 [Arabidopsis thaliana] Length = 527 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|NP_849700.1| auxin efflux carrier component 7 [Arabidopsis thaliana] gi|42558877|sp|Q940Y5.2|PIN7_ARATH RecName: Full=Auxin efflux carrier component 7; Short=AtPIN7 gi|5817305|gb|AAD52697.1|AF087820_1 auxin transport protein [Arabidopsis thaliana] gi|332192211|gb|AEE30332.1| auxin efflux carrier component 7 [Arabidopsis thaliana] Length = 619 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >gb|AFJ03880.1| auxin transport protein [Capsella bursa-pastoris] Length = 618 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|XP_002893260.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata] gi|297339102|gb|EFH69519.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata] Length = 614 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54 >ref|NP_001077584.1| auxin efflux carrier component 7 [Arabidopsis thaliana] gi|222423080|dbj|BAH19520.1| AT1G23080 [Arabidopsis thaliana] gi|332192213|gb|AEE30334.1| auxin efflux carrier component 7 [Arabidopsis thaliana] Length = 615 Score = 109 bits (272), Expect = 4e-22 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 164 MISWHDLYTVLAAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLL 3 MI+WHDLYTVL AV+PLYVAMILAYGSVRWW IFSPDQCSGINRFVAIFAVPLL Sbjct: 1 MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLL 54