BLASTX nr result
ID: Zingiber23_contig00030233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00030233 (236 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276148.2| PREDICTED: AT-rich interactive domain-contai... 59 5e-07 emb|CBI40441.3| unnamed protein product [Vitis vinifera] 59 5e-07 emb|CAN80959.1| hypothetical protein VITISV_037562 [Vitis vinifera] 59 5e-07 ref|XP_006491145.1| PREDICTED: AT-rich interactive domain-contai... 56 4e-06 ref|XP_006491143.1| PREDICTED: AT-rich interactive domain-contai... 56 4e-06 ref|XP_006445001.1| hypothetical protein CICLE_v10019137mg [Citr... 56 4e-06 >ref|XP_002276148.2| PREDICTED: AT-rich interactive domain-containing protein 1-like [Vitis vinifera] Length = 628 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWL 144 V+ +GGY VS+ W VAE GLDS +G +LKLV++KYLD+LD+WL Sbjct: 90 VKEKGGYRTVSENVLWNLVAEESGLDSGVGSALKLVYIKYLDLLDRWL 137 >emb|CBI40441.3| unnamed protein product [Vitis vinifera] Length = 594 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWL 144 V+ +GGY VS+ W VAE GLDS +G +LKLV++KYLD+LD+WL Sbjct: 97 VKEKGGYRTVSENVLWNLVAEESGLDSGVGSALKLVYIKYLDLLDRWL 144 >emb|CAN80959.1| hypothetical protein VITISV_037562 [Vitis vinifera] Length = 724 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWL 144 V+ +GGY VS+ W VAE GLDS +G +LKLV++KYLD+LD+WL Sbjct: 90 VKEKGGYRTVSENVLWNLVAEESGLDSGVGSALKLVYIKYLDLLDRWL 137 >ref|XP_006491145.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X3 [Citrus sinensis] gi|568876146|ref|XP_006491146.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X4 [Citrus sinensis] gi|568876148|ref|XP_006491147.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X5 [Citrus sinensis] gi|568876150|ref|XP_006491148.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X6 [Citrus sinensis] Length = 685 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWLQWV 153 V+ +GGYG+V++ W VA+ GLDS S+KLV++KYLD L++WL+ V Sbjct: 85 VREKGGYGSVTENGFWDLVAKESGLDSSFSSSVKLVYVKYLDALERWLERV 135 >ref|XP_006491143.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Citrus sinensis] gi|568876142|ref|XP_006491144.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Citrus sinensis] Length = 690 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWLQWV 153 V+ +GGYG+V++ W VA+ GLDS S+KLV++KYLD L++WL+ V Sbjct: 90 VREKGGYGSVTENGFWDLVAKESGLDSSFSSSVKLVYVKYLDALERWLERV 140 >ref|XP_006445001.1| hypothetical protein CICLE_v10019137mg [Citrus clementina] gi|557547263|gb|ESR58241.1| hypothetical protein CICLE_v10019137mg [Citrus clementina] Length = 685 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 1 VQREGGYGAVSKERKWKSVAEAMGLDSFMGPSLKLVFLKYLDVLDQWLQWV 153 V+ +GGYG+V++ W VA+ GLDS S+KLV++KYLD L++WL+ V Sbjct: 85 VREKGGYGSVTENGFWDLVAKESGLDSSFSSSVKLVYVKYLDALERWLERV 135