BLASTX nr result
ID: Zingiber23_contig00029223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00029223 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, p... 78 1e-12 ref|XP_006664030.1| PREDICTED: disease resistance protein RPS2-l... 56 6e-06 >gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, partial [Zingiber zerumbet] Length = 759 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 LTELQYLNLSSNPITRLSAKFGCLIKLEYLLLRNTDLEIVPNGTI 135 LTELQYLNLSSNPITRL +FGCL KLEYLLLR+T+L+IVPNGTI Sbjct: 715 LTELQYLNLSSNPITRLPIEFGCLSKLEYLLLRDTNLKIVPNGTI 759 >ref|XP_006664030.1| PREDICTED: disease resistance protein RPS2-like [Oryza brachyantha] Length = 943 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +1 Query: 1 LTELQYLNLSSNPITRLSAKFGCLIKLEYLLLRNTDLEIVPNGTISNLSMLKWLD 165 L L YLNLS N I L + GCL+KLEYLLLR+ + +P +S LS LK +D Sbjct: 573 LVNLYYLNLSENKIKYLPQELGCLLKLEYLLLRSNPINDIPEDILSKLSRLKVVD 627