BLASTX nr result
ID: Zingiber23_contig00028775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00028775 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28813.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -3 Query: 154 NLPWLPTPELASQFPILRHLLSCTSMRHLHQIHSHTLTSGAFRDPFVASRV 2 N PW+PTP+L ++PILRHL SC +++ L QIH+ T+T+G F D FVASR+ Sbjct: 59 NPPWIPTPQLLCKYPILRHLSSCKTLKDLTQIHAQTITTGIFSDNFVASRI 109 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -3 Query: 154 NLPWLPTPELASQFPILRHLLSCTSMRHLHQIHSHTLTSGAFRDPFVASRV 2 N PW+PTP+L ++PILRHL SC +++ L QIH+ T+T+G F D FVASR+ Sbjct: 23 NPPWIPTPQLLCKYPILRHLSSCKTLKDLTQIHAQTITTGIFSDNFVASRI 73