BLASTX nr result
ID: Zingiber23_contig00027011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00027011 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW79520.1| putative MYB DNA-binding domain superfamily prote... 55 1e-05 >gb|AFW79520.1| putative MYB DNA-binding domain superfamily protein [Zea mays] Length = 297 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = +2 Query: 236 MEAAAEKWTREDDKRFEDALATVASQPEENGDGGAWWEMIAARVPGKTAAEVRR 397 + AA WTRE+DK FE+A+A A+ P++ W+ + A VP +TA EVRR Sbjct: 4 LATAAAAWTREEDKAFENAVAAAAAPPDDGPPDDGWFTALVASVPARTAEEVRR 57