BLASTX nr result
ID: Zingiber23_contig00026677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026677 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW61141.1| hypothetical protein ZEAMMB73_943069, partial [Ze... 60 3e-07 >gb|AFW61141.1| hypothetical protein ZEAMMB73_943069, partial [Zea mays] Length = 185 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/102 (32%), Positives = 57/102 (55%), Gaps = 6/102 (5%) Frame = +2 Query: 2 GPSPVVPFLLVAALTMFICREDLRNGYDYVSGVQDKTVLFLVILP------MIGFFAVQS 163 GPSPVVP L+VAAL IC+E L Y+ V+ VQ+ V+L ++ + Sbjct: 18 GPSPVVPLLVVAALGWVICQETLMGWYEQVTEVQETVADNAVLLVLGAGVLLLALAVAGN 77 Query: 164 STEKIVIPIAFCTVVFLLRTQLLGPIVVLVLIHLLSKWYRTP 289 +E +++P A V+FL++ +L +++LV+++ +Y P Sbjct: 78 RSEVVLVPAALVLVMFLIQNIVLAALLLLVVVYFAGIYYYRP 119