BLASTX nr result
ID: Zingiber23_contig00026660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026660 (512 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479952.1| PREDICTED: phytochrome A-associated F-box pr... 85 9e-15 ref|XP_006444317.1| hypothetical protein CICLE_v10021114mg [Citr... 85 9e-15 gb|EMJ02739.1| hypothetical protein PRUPE_ppa017065mg, partial [... 85 9e-15 ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box pr... 85 9e-15 ref|XP_002523077.1| Phytochrome A-associated F-box protein, puta... 85 9e-15 gb|ESW35102.1| hypothetical protein PHAVU_001G207000g [Phaseolus... 84 1e-14 ref|NP_192153.1| phytochrome A-associated F-box protein EID1 [Ar... 84 2e-14 gb|AAM62754.1| unknown [Arabidopsis thaliana] 84 2e-14 dbj|BAJ34329.1| unnamed protein product [Thellungiella halophila] 84 2e-14 gb|EXC58829.1| Phytochrome A-associated F-box protein [Morus not... 84 3e-14 gb|EOX95070.1| F-box family protein [Theobroma cacao] 84 3e-14 ref|XP_006286683.1| hypothetical protein CARUB_v10002672mg [Caps... 83 3e-14 emb|CBI36850.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002266159.1| PREDICTED: phytochrome A-associated F-box pr... 83 3e-14 emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] 83 3e-14 ref|XP_006359377.1| PREDICTED: phytochrome A-associated F-box pr... 83 4e-14 ref|XP_004247422.1| PREDICTED: phytochrome A-associated F-box pr... 83 4e-14 gb|EPS68049.1| hypothetical protein M569_06722 [Genlisea aurea] 82 7e-14 ref|XP_004494375.1| PREDICTED: phytochrome A-associated F-box pr... 82 7e-14 ref|XP_004290789.1| PREDICTED: phytochrome A-associated F-box pr... 81 1e-13 >ref|XP_006479952.1| PREDICTED: phytochrome A-associated F-box protein-like [Citrus sinensis] Length = 326 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 287 SAFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLY 325 >ref|XP_006444317.1| hypothetical protein CICLE_v10021114mg [Citrus clementina] gi|557546579|gb|ESR57557.1| hypothetical protein CICLE_v10021114mg [Citrus clementina] Length = 328 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 289 SAFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLY 327 >gb|EMJ02739.1| hypothetical protein PRUPE_ppa017065mg, partial [Prunus persica] Length = 321 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 282 SAFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLY 320 >ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box protein-like [Cucumis sativus] Length = 379 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 340 SAFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLY 378 >ref|XP_002523077.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] gi|223537639|gb|EEF39262.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] Length = 332 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEP+VRAYVCENGHVSGAWT+ PLY Sbjct: 293 SAFCLRRVFGYHDDGEPIVRAYVCENGHVSGAWTDVPLY 331 >gb|ESW35102.1| hypothetical protein PHAVU_001G207000g [Phaseolus vulgaris] Length = 319 Score = 84.3 bits (207), Expect = 1e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FGFHDDGEPVVRAYVCENGHVSGAWT+ P+Y Sbjct: 280 SAFCLRRAFGFHDDGEPVVRAYVCENGHVSGAWTDVPMY 318 >ref|NP_192153.1| phytochrome A-associated F-box protein EID1 [Arabidopsis thaliana] gi|68052208|sp|Q8LEA8.2|EID1_ARATH RecName: Full=Phytochrome A-associated F-box protein; AltName: Full=Empfindlicher im dunkelroten Licht protein 1 gi|3193286|gb|AAC19270.1| T14P8.22 [Arabidopsis thaliana] gi|7269004|emb|CAB80737.1| putative protein [Arabidopsis thaliana] gi|25083158|gb|AAN72049.1| putative protein [Arabidopsis thaliana] gi|30984562|gb|AAP42744.1| At4g02440 [Arabidopsis thaliana] gi|110739507|dbj|BAF01662.1| EID1 [Arabidopsis thaliana] gi|332656772|gb|AEE82172.1| phytochrome A-associated F-box protein EID1 [Arabidopsis thaliana] Length = 336 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 S+FCLRRVFGFHDDGEPVVRAYVCENGHVSGAWT PLY Sbjct: 297 SSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLY 335 >gb|AAM62754.1| unknown [Arabidopsis thaliana] Length = 337 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 S+FCLRRVFGFHDDGEPVVRAYVCENGHVSGAWT PLY Sbjct: 298 SSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLY 336 >dbj|BAJ34329.1| unnamed protein product [Thellungiella halophila] Length = 337 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 S+FCLRRVFGFHDDGEPVVRAYVCENGHVSGAWT PLY Sbjct: 298 SSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLY 336 >gb|EXC58829.1| Phytochrome A-associated F-box protein [Morus notabilis] Length = 322 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FGFHDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 283 SAFCLRRGFGFHDDGEPVVRAYVCENGHVSGAWTDLPLY 321 >gb|EOX95070.1| F-box family protein [Theobroma cacao] Length = 327 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRRVFG+HDDGEPVVRA+VCENGHVSGAWT+ PLY Sbjct: 288 SAFCLRRVFGYHDDGEPVVRAFVCENGHVSGAWTDLPLY 326 >ref|XP_006286683.1| hypothetical protein CARUB_v10002672mg [Capsella rubella] gi|482555389|gb|EOA19581.1| hypothetical protein CARUB_v10002672mg [Capsella rubella] Length = 322 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 S+FCLRRV+GFHDDGEPVVRAYVCENGHVSGAWT PLY Sbjct: 283 SSFCLRRVYGFHDDGEPVVRAYVCENGHVSGAWTSLPLY 321 >emb|CBI36850.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVCENGHVSGAWTE PLY Sbjct: 245 SAFCLRRGFGYHDDGEPVVRAYVCENGHVSGAWTEYPLY 283 >ref|XP_002266159.1| PREDICTED: phytochrome A-associated F-box protein-like [Vitis vinifera] Length = 330 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVCENGHVSGAWTE PLY Sbjct: 291 SAFCLRRGFGYHDDGEPVVRAYVCENGHVSGAWTEYPLY 329 >emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] Length = 720 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVCENGHVSGAWTE PLY Sbjct: 681 SAFCLRRGFGYHDDGEPVVRAYVCENGHVSGAWTEYPLY 719 >ref|XP_006359377.1| PREDICTED: phytochrome A-associated F-box protein-like [Solanum tuberosum] Length = 332 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 293 SAFCLRRYFGYHDDGEPVVRAYVCENGHVSGAWTDWPLY 331 >ref|XP_004247422.1| PREDICTED: phytochrome A-associated F-box protein-like [Solanum lycopersicum] Length = 325 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 286 SAFCLRRYFGYHDDGEPVVRAYVCENGHVSGAWTDWPLY 324 >gb|EPS68049.1| hypothetical protein M569_06722 [Genlisea aurea] Length = 338 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 S+FCLRR FGFHDDGEPVVRAYVCENGHVSGAWT+ P+Y Sbjct: 299 SSFCLRRYFGFHDDGEPVVRAYVCENGHVSGAWTDWPMY 337 >ref|XP_004494375.1| PREDICTED: phytochrome A-associated F-box protein-like [Cicer arietinum] Length = 299 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FGFHDDGEPVVRAYVC+NGHVSGAWT+ P+Y Sbjct: 260 SAFCLRRGFGFHDDGEPVVRAYVCDNGHVSGAWTDVPMY 298 >ref|XP_004290789.1| PREDICTED: phytochrome A-associated F-box protein-like [Fragaria vesca subsp. vesca] Length = 301 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 512 SAFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTETPLY 396 SAFCLRR FG+HDDGEPVVRAYVC+NGHVSGAWT+ PLY Sbjct: 262 SAFCLRRGFGYHDDGEPVVRAYVCDNGHVSGAWTDLPLY 300