BLASTX nr result
ID: Zingiber23_contig00026630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026630 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|4JVS|B Chain B, Crystal Structure Of Lepb Gap Domain From Le... 66 4e-09 gb|ESN96834.1| hypothetical protein HELRODRAFT_185942 [Helobdell... 65 1e-08 ref|XP_004533560.1| PREDICTED: ras-related protein Rab-1A-like [... 65 1e-08 gb|EMJ20000.1| hypothetical protein PRUPE_ppa009820mg [Prunus pe... 64 2e-08 ref|XP_006240866.1| PREDICTED: LOW QUALITY PROTEIN: ras-related ... 64 3e-08 emb|CDJ86514.1| Ras domain containing protein [Haemonchus contor... 64 3e-08 ref|XP_005489445.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005366508.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005366507.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005147502.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005147501.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005070453.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 ref|XP_005070452.1| PREDICTED: ras-related protein Rab-1A isofor... 64 3e-08 gb|ELR57927.1| Ras-related protein Rab-1A, partial [Bos mutus] 64 3e-08 ref|XP_002709884.1| PREDICTED: RAB1A, member RAS oncogene family... 64 3e-08 gb|AAV38334.1| RAB1A, member RAS oncogene family [synthetic cons... 64 3e-08 gb|AAB16966.1| rab1-like, partial [Caenorhabditis elegans] 64 3e-08 gb|AAA42006.1| ras protein [Rattus norvegicus] 64 3e-08 ref|NP_001028800.1| ras-related protein Rab-1A [Bos taurus] gi|4... 64 3e-08 ref|NP_001004787.1| RAB1A, member RAS oncogene family [Xenopus (... 64 3e-08 >pdb|4JVS|B Chain B, Crystal Structure Of Lepb Gap Domain From Legionella Drancourtii In Complex With Rab1-gdp And Alf3 Length = 181 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 98 PVSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 P+S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 4 PMSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 35 >gb|ESN96834.1| hypothetical protein HELRODRAFT_185942 [Helobdella robusta] Length = 204 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +SAMNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_004533560.1| PREDICTED: ras-related protein Rab-1A-like [Ceratitis capitata] Length = 205 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +SAMNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >gb|EMJ20000.1| hypothetical protein PRUPE_ppa009820mg [Prunus persica] Length = 276 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 LPVSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 L V+ MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 70 LAVTVMNPEYDYLFKLLLIGDSGVGKSCLLLRF 102 >ref|XP_006240866.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab-1A-like [Rattus norvegicus] Length = 208 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >emb|CDJ86514.1| Ras domain containing protein [Haemonchus contortus] Length = 205 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 ++AMNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MAAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005489445.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Zonotrichia albicollis] gi|543364200|ref|XP_005525464.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Pseudopodoces humilis] Length = 129 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005366508.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Microtus ochrogaster] Length = 129 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005366507.1| PREDICTED: ras-related protein Rab-1A isoform X1 [Microtus ochrogaster] Length = 205 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005147502.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Melopsittacus undulatus] Length = 129 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005147501.1| PREDICTED: ras-related protein Rab-1A isoform X1 [Melopsittacus undulatus] Length = 205 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005070453.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Mesocricetus auratus] Length = 173 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|XP_005070452.1| PREDICTED: ras-related protein Rab-1A isoform X1 [Mesocricetus auratus] Length = 205 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >gb|ELR57927.1| Ras-related protein Rab-1A, partial [Bos mutus] Length = 246 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 42 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 72 >ref|XP_002709884.1| PREDICTED: RAB1A, member RAS oncogene family isoform 2 [Oryctolagus cuniculus] gi|332813298|ref|XP_003309085.1| PREDICTED: ras-related protein Rab-1A isoform 1 [Pan troglodytes] gi|395731757|ref|XP_003775962.1| PREDICTED: ras-related protein Rab-1A [Pongo abelii] gi|397521757|ref|XP_003830954.1| PREDICTED: ras-related protein Rab-1A [Pan paniscus] gi|472355791|ref|XP_004397542.1| PREDICTED: ras-related protein Rab-1A isoform 3 [Odobenus rosmarus divergens] gi|504135342|ref|XP_004580148.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Ochotona princeps] gi|505804410|ref|XP_004609232.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Sorex araneus] gi|507664186|ref|XP_004636207.1| PREDICTED: ras-related protein Rab-1A isoform X3 [Octodon degus] gi|507679341|ref|XP_004710231.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Echinops telfairi] gi|507973768|ref|XP_004691513.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Condylura cristata] gi|530367912|ref|XP_005264525.1| PREDICTED: ras-related protein Rab-1A isoform X1 [Homo sapiens] gi|544480970|ref|XP_005575792.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Macaca fascicularis] gi|545186550|ref|XP_005599987.1| PREDICTED: ras-related protein Rab-1A isoform X3 [Equus caballus] gi|555963065|ref|XP_005893619.1| PREDICTED: ras-related protein Rab-1A isoform X3 [Bos mutus] gi|560958228|ref|XP_006201577.1| PREDICTED: ras-related protein Rab-1A isoform X3 [Vicugna pacos] gi|585194591|ref|XP_006748471.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Leptonychotes weddellii] gi|585641635|ref|XP_006881027.1| PREDICTED: ras-related protein Rab-1A isoform X1 [Elephantulus edwardii] gi|586464780|ref|XP_006863017.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Chrysochloris asiatica] gi|221044672|dbj|BAH14013.1| unnamed protein product [Homo sapiens] Length = 173 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >gb|AAV38334.1| RAB1A, member RAS oncogene family [synthetic construct] gi|61365844|gb|AAX42772.1| RAB1A member RAS oncogene family [synthetic construct] Length = 206 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >gb|AAB16966.1| rab1-like, partial [Caenorhabditis elegans] Length = 69 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 ++AMNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MAAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >gb|AAA42006.1| ras protein [Rattus norvegicus] Length = 205 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|NP_001028800.1| ras-related protein Rab-1A [Bos taurus] gi|466062556|ref|XP_004280671.1| PREDICTED: ras-related protein Rab-1A isoform 2 [Orcinus orca] gi|472355789|ref|XP_004397541.1| PREDICTED: ras-related protein Rab-1A isoform 2 [Odobenus rosmarus divergens] gi|555963063|ref|XP_005893618.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Bos mutus] gi|560958226|ref|XP_006201576.1| PREDICTED: ras-related protein Rab-1A isoform X2 [Vicugna pacos] gi|73586795|gb|AAI03437.1| RAB1A, member RAS oncogene family [Bos taurus] gi|148675883|gb|EDL07830.1| RAB1, member RAS oncogene family, isoform CRA_b [Mus musculus] gi|149044749|gb|EDL97935.1| rCG23301, isoform CRA_c [Rattus norvegicus] gi|296482422|tpg|DAA24537.1| TPA: GTP binding protein Rab1a [Bos taurus] Length = 173 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31 >ref|NP_001004787.1| RAB1A, member RAS oncogene family [Xenopus (Silurana) tropicalis] gi|148230336|ref|NP_001080138.1| RAB1A, member RAS oncogene family [Xenopus laevis] gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] gi|49250530|gb|AAH74522.1| RAB1A, member RAS oncogene family [Xenopus (Silurana) tropicalis] gi|117557991|gb|AAI27357.1| RAB1A, member RAS oncogene family [Xenopus (Silurana) tropicalis] Length = 204 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 VSAMNPEYDYLFKLLLIGDSGVGKSCLLLRF 3 +S+MNPEYDYLFKLLLIGDSGVGKSCLLLRF Sbjct: 1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRF 31