BLASTX nr result
ID: Zingiber23_contig00026255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026255 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312634.2| hypothetical protein POPTR_0008s17750g [Popu... 57 2e-06 ref|XP_006408550.1| hypothetical protein EUTSA_v10020012mg [Eutr... 56 4e-06 ref|XP_006845238.1| hypothetical protein AMTR_s00005p00258270 [A... 55 1e-05 >ref|XP_002312634.2| hypothetical protein POPTR_0008s17750g [Populus trichocarpa] gi|550333322|gb|EEE90001.2| hypothetical protein POPTR_0008s17750g [Populus trichocarpa] Length = 978 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 184 MVLGLRSKQKKGTSFLVDCIIHIHEIKPWPPSQS 285 MVLGLRSK +KGTS VD IH+ EIKPWPPSQS Sbjct: 1 MVLGLRSKNRKGTSVQVDYTIHVQEIKPWPPSQS 34 >ref|XP_006408550.1| hypothetical protein EUTSA_v10020012mg [Eutrema salsugineum] gi|557109696|gb|ESQ50003.1| hypothetical protein EUTSA_v10020012mg [Eutrema salsugineum] Length = 919 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 184 MVLGLRSKQKKGTSFLVDCIIHIHEIKPWPPSQS 285 MVLGL SK ++G+S VD +IHIH+IKPWPPSQS Sbjct: 1 MVLGLSSKNRRGSSIQVDYLIHIHDIKPWPPSQS 34 >ref|XP_006845238.1| hypothetical protein AMTR_s00005p00258270 [Amborella trichopoda] gi|548847751|gb|ERN06913.1| hypothetical protein AMTR_s00005p00258270 [Amborella trichopoda] Length = 243 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 184 MVLGLRSKQKKGTSFLVDCIIHIHEIKPWPPSQS 285 MVLGLR+K +KG++ VD +IHI EIKPWPPSQS Sbjct: 1 MVLGLRTKNRKGSTVNVDYVIHIQEIKPWPPSQS 34