BLASTX nr result
ID: Zingiber23_contig00026067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026067 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423246.1| hypothetical protein CICLE_v10029292mg [Citr... 92 6e-17 ref|XP_004969959.1| PREDICTED: ras-related protein Rab7-like [Se... 91 1e-16 gb|EMT06597.1| Ras-related protein Rab7 [Aegilops tauschii] 91 1e-16 gb|EMS52758.1| Ras-related protein Rab7 [Triticum urartu] 91 1e-16 dbj|BAJ95468.1| predicted protein [Hordeum vulgare subsp. vulgar... 91 1e-16 ref|XP_006856034.1| hypothetical protein AMTR_s00059p00072050 [A... 91 2e-16 gb|EOX98049.1| RAB GTPase G3F isoform 3, partial [Theobroma cacao] 91 2e-16 gb|EOX98047.1| RAB GTPase G3F isoform 1 [Theobroma cacao] 91 2e-16 gb|EMT20561.1| Ras-related protein Rab7 [Aegilops tauschii] 91 2e-16 gb|EMS62852.1| Ras-related protein Rab7 [Triticum urartu] 91 2e-16 ref|XP_004302908.1| PREDICTED: ras-related protein Rab7-like [Fr... 91 2e-16 sp|Q40787.1|RAB7_CENCI RecName: Full=Ras-related protein Rab7 gi... 91 2e-16 gb|AFW78722.1| hypothetical protein ZEAMMB73_253903 [Zea mays] g... 91 2e-16 gb|AFW78721.1| hypothetical protein ZEAMMB73_253903 [Zea mays] g... 91 2e-16 ref|XP_003568100.1| PREDICTED: ras-related protein Rab7-like iso... 91 2e-16 ref|XP_003568099.1| PREDICTED: ras-related protein Rab7-like iso... 91 2e-16 ref|XP_003568096.1| PREDICTED: ras-related protein Rab7-like iso... 91 2e-16 ref|XP_003568095.1| PREDICTED: ras-related protein Rab7-like iso... 91 2e-16 dbj|BAJ90488.1| predicted protein [Hordeum vulgare subsp. vulgare] 91 2e-16 ref|NP_001169258.1| hypothetical protein [Zea mays] gi|242088493... 91 2e-16 >ref|XP_006423246.1| hypothetical protein CICLE_v10029292mg [Citrus clementina] gi|568867669|ref|XP_006487156.1| PREDICTED: ras-related protein Rab7-like [Citrus sinensis] gi|557525180|gb|ESR36486.1| hypothetical protein CICLE_v10029292mg [Citrus clementina] Length = 206 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF+VLGN+ID DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSE 139 >ref|XP_004969959.1| PREDICTED: ras-related protein Rab7-like [Setaria italica] Length = 206 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDIDGGNSRVVSE 139 >gb|EMT06597.1| Ras-related protein Rab7 [Aegilops tauschii] Length = 197 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 84 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDIDGGNSRVVSE 130 >gb|EMS52758.1| Ras-related protein Rab7 [Triticum urartu] Length = 176 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 84 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDIDGGNSRVVSE 130 >dbj|BAJ95468.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533112|dbj|BAJ93528.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 206 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDIDGGNSRVVSE 139 >ref|XP_006856034.1| hypothetical protein AMTR_s00059p00072050 [Amborella trichopoda] gi|548859893|gb|ERN17501.1| hypothetical protein AMTR_s00059p00072050 [Amborella trichopoda] Length = 161 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDP+NFPF+VLGN+ID DGGN+RVVSE Sbjct: 48 MKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSE 94 >gb|EOX98049.1| RAB GTPase G3F isoform 3, partial [Theobroma cacao] Length = 161 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDP+NFPF+VLGN+ID DGGN+RVVSE Sbjct: 73 MKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSE 119 >gb|EOX98047.1| RAB GTPase G3F isoform 1 [Theobroma cacao] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDP+NFPF+VLGN+ID DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSE 139 >gb|EMT20561.1| Ras-related protein Rab7 [Aegilops tauschii] Length = 223 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 110 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 156 >gb|EMS62852.1| Ras-related protein Rab7 [Triticum urartu] Length = 264 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 142 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 188 >ref|XP_004302908.1| PREDICTED: ras-related protein Rab7-like [Fragaria vesca subsp. vesca] Length = 207 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDP+NFPF+VLGN+ID DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSE 139 >sp|Q40787.1|RAB7_CENCI RecName: Full=Ras-related protein Rab7 gi|1155265|gb|AAA85273.1| possible apospory-associated protein [Cenchrus ciliaris] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 139 >gb|AFW78722.1| hypothetical protein ZEAMMB73_253903 [Zea mays] gi|414591125|tpg|DAA41696.1| TPA: hypothetical protein ZEAMMB73_061376 [Zea mays] Length = 114 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 1 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 47 >gb|AFW78721.1| hypothetical protein ZEAMMB73_253903 [Zea mays] gi|414591124|tpg|DAA41695.1| TPA: hypothetical protein ZEAMMB73_061376 [Zea mays] Length = 197 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 84 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 130 >ref|XP_003568100.1| PREDICTED: ras-related protein Rab7-like isoform 2 [Brachypodium distachyon] Length = 196 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 83 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 129 >ref|XP_003568099.1| PREDICTED: ras-related protein Rab7-like isoform 1 [Brachypodium distachyon] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 139 >ref|XP_003568096.1| PREDICTED: ras-related protein Rab7-like isoform 2 [Brachypodium distachyon] Length = 199 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 86 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 132 >ref|XP_003568095.1| PREDICTED: ras-related protein Rab7-like isoform 1 [Brachypodium distachyon] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 139 >dbj|BAJ90488.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 139 >ref|NP_001169258.1| hypothetical protein [Zea mays] gi|242088493|ref|XP_002440079.1| hypothetical protein SORBIDRAFT_09g025620 [Sorghum bicolor] gi|514747961|ref|XP_004961498.1| PREDICTED: ras-related protein Rab7-like [Setaria italica] gi|223975857|gb|ACN32116.1| unknown [Zea mays] gi|241945364|gb|EES18509.1| hypothetical protein SORBIDRAFT_09g025620 [Sorghum bicolor] gi|413946071|gb|AFW78720.1| hypothetical protein ZEAMMB73_253903 [Zea mays] gi|414591123|tpg|DAA41694.1| TPA: hypothetical protein ZEAMMB73_061376 [Zea mays] Length = 206 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 354 MKSFDNLNNWWEEFLIQASPSDPDNFPFIVLGNQIDFDGGNNRVVSE 214 MKSFDNLNNW EEFLIQASPSDPDNFPF++LGN++D DGGN+RVVSE Sbjct: 93 MKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSE 139