BLASTX nr result
ID: Zingiber23_contig00024181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00024181 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309648.1| serine-rich family protein [Populus trichoca... 56 4e-06 >ref|XP_002309648.1| serine-rich family protein [Populus trichocarpa] gi|118488280|gb|ABK95959.1| unknown [Populus trichocarpa] gi|222855624|gb|EEE93171.1| serine-rich family protein [Populus trichocarpa] Length = 210 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -3 Query: 150 QYQRHRAASPTRVHLYGASPPHPPVVRFSLDRSTSPGRSLSVPDK 16 Q R+ASPTRV+LY + PP P RFS+DRSTSP RS+SV K Sbjct: 59 QNSHQRSASPTRVNLYSSCPPLSPSFRFSIDRSTSPNRSISVSKK 103