BLASTX nr result
ID: Zingiber23_contig00022937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00022937 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_178143.1| pentatricopeptide repeat-containing protein [Ar... 86 7e-15 gb|EOY08858.1| Pentatricopeptide repeat-containing protein isofo... 85 9e-15 gb|EOY08857.1| Pentatricopeptide repeat-containing protein isofo... 85 9e-15 ref|XP_006430551.1| hypothetical protein CICLE_v10011296mg [Citr... 84 2e-14 ref|XP_004499885.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_004493398.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_004493397.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_006482077.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 ref|XP_004967670.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 gb|ESW17930.1| hypothetical protein PHAVU_007G280400g [Phaseolus... 80 3e-13 ref|XP_004162629.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_002889301.1| hypothetical protein ARALYDRAFT_477224 [Arab... 79 5e-13 ref|XP_004303594.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|XP_003590264.1| Pentatricopeptide repeat-containing protein ... 78 1e-12 ref|XP_003590239.1| Pentatricopeptide repeat-containing protein ... 78 1e-12 ref|XP_003567340.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_004162628.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 gb|AFW79512.1| DNA-binding protein [Zea mays] 76 4e-12 gb|ADN33878.1| DNA-binding protein [Cucumis melo subsp. melo] 76 4e-12 ref|NP_001147602.1| DNA-binding protein [Zea mays] gi|195612448|... 76 4e-12 >ref|NP_178143.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|42572199|ref|NP_974190.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|145327755|ref|NP_001077853.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75262222|sp|Q9C977.1|PP135_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g80270, mitochondrial; Flags: Precursor gi|12324975|gb|AAG52431.1|AC018848_2 hypothetical protein; 8785-10851 [Arabidopsis thaliana] gi|17064898|gb|AAL32603.1| Unknown protein [Arabidopsis thaliana] gi|20259918|gb|AAM13306.1| unknown protein [Arabidopsis thaliana] gi|332198258|gb|AEE36379.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332198259|gb|AEE36380.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332198260|gb|AEE36381.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 596 Score = 85.5 bits (210), Expect = 7e-15 Identities = 46/96 (47%), Positives = 60/96 (62%) Frame = -3 Query: 289 LDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAM 110 LDL++ S +K S +F+ I+ P S+ SALDK+ EEG + EI+ AM Sbjct: 113 LDLIETDVSRKTVEK-----KQSELFKTIVSAPGLSIGSALDKWVEEGNEITRVEIAKAM 167 Query: 109 LNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 L LR+RR+Y ALQ EWLEA KKIE+T+RDY S L Sbjct: 168 LQLRRRRMYGRALQMSEWLEANKKIEMTERDYASRL 203 >gb|EOY08858.1| Pentatricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] Length = 621 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/83 (50%), Positives = 56/83 (67%) Frame = -3 Query: 250 KKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMAL 71 KK +R S +F+ ++ P S+ LDK+ EEGK+ EIS+AMLNLRKRR+Y AL Sbjct: 146 KKSSTRRIVSELFKAVIAAPGLSVHKVLDKWLEEGKAFNRTEISVAMLNLRKRRMYGRAL 205 Query: 70 QFVEWLEARKKIELTDRDYVSHL 2 Q EWLEA K+++ T+RDY S L Sbjct: 206 QLSEWLEANKQLDFTERDYASRL 228 >gb|EOY08857.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 623 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/83 (50%), Positives = 56/83 (67%) Frame = -3 Query: 250 KKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMAL 71 KK +R S +F+ ++ P S+ LDK+ EEGK+ EIS+AMLNLRKRR+Y AL Sbjct: 148 KKSSTRRIVSELFKAVIAAPGLSVHKVLDKWLEEGKAFNRTEISVAMLNLRKRRMYGRAL 207 Query: 70 QFVEWLEARKKIELTDRDYVSHL 2 Q EWLEA K+++ T+RDY S L Sbjct: 208 QLSEWLEANKQLDFTERDYASRL 230 >ref|XP_006430551.1| hypothetical protein CICLE_v10011296mg [Citrus clementina] gi|557532608|gb|ESR43791.1| hypothetical protein CICLE_v10011296mg [Citrus clementina] Length = 623 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/88 (48%), Positives = 54/88 (61%) Frame = -3 Query: 265 SEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRL 86 +E K S+ S +F+ IMD P S+ S L KYAEEG L EI++AM NLR RR+ Sbjct: 143 TEASRKTTPSKRKFSKLFKAIMDAPDISIHSTLTKYAEEGNDLSRAEIALAMANLRTRRM 202 Query: 85 YSMALQFVEWLEARKKIELTDRDYVSHL 2 Y ALQ EWLE KK++ +RDY S L Sbjct: 203 YGKALQLSEWLETNKKLDFIERDYASCL 230 >ref|XP_004499885.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Cicer arietinum] Length = 615 Score = 83.6 bits (205), Expect = 3e-14 Identities = 44/99 (44%), Positives = 67/99 (67%) Frame = -3 Query: 298 YGSLDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEIS 119 + L+L D + S+ AK SR S +F+ +++ P + SAL+K+ E+GK L EI+ Sbjct: 128 HNELELSDTE-SDLDAKNSESRNKRSELFKAVVNGP---VDSALNKWVEKGKELSRQEIT 183 Query: 118 IAMLNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 +A+LNLRKR++Y ALQ +EWLE+ KK+E T++DY S L Sbjct: 184 LALLNLRKRKMYGRALQVLEWLESNKKLEFTEKDYASKL 222 >ref|XP_004493398.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like isoform X2 [Cicer arietinum] Length = 603 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/83 (49%), Positives = 54/83 (65%) Frame = -3 Query: 250 KKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMAL 71 KK + S +F+ IMD P S+ +ALDK+ EEGK L EIS+ M NLR+R++Y AL Sbjct: 129 KKSSQKRVLSELFKDIMDAPGLSVRTALDKWVEEGKELSREEISLTMANLRRRKMYGRAL 188 Query: 70 QFVEWLEARKKIELTDRDYVSHL 2 Q EWLE++K +E D DY S L Sbjct: 189 QLSEWLESKKHLEFVDSDYASRL 211 >ref|XP_004493397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like isoform X1 [Cicer arietinum] Length = 609 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/83 (49%), Positives = 54/83 (65%) Frame = -3 Query: 250 KKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMAL 71 KK + S +F+ IMD P S+ +ALDK+ EEGK L EIS+ M NLR+R++Y AL Sbjct: 135 KKSSQKRVLSELFKDIMDAPGLSVRTALDKWVEEGKELSREEISLTMANLRRRKMYGRAL 194 Query: 70 QFVEWLEARKKIELTDRDYVSHL 2 Q EWLE++K +E D DY S L Sbjct: 195 QLSEWLESKKHLEFVDSDYASRL 217 >ref|XP_006482077.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Citrus sinensis] Length = 623 Score = 82.0 bits (201), Expect = 7e-14 Identities = 43/88 (48%), Positives = 52/88 (59%) Frame = -3 Query: 265 SEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRL 86 +E K S+ S +F+ IMD P S S L Y EEG L EIS+AM NLR RR+ Sbjct: 143 TEPSRKTTPSKRKLSKLFKAIMDAPDISNNSTLTTYVEEGNDLSRAEISLAMANLRTRRM 202 Query: 85 YSMALQFVEWLEARKKIELTDRDYVSHL 2 Y ALQF EWLE KK++ +RDY S L Sbjct: 203 YGKALQFSEWLETNKKLDFIERDYASRL 230 >ref|XP_004967670.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Setaria italica] Length = 613 Score = 82.0 bits (201), Expect = 7e-14 Identities = 40/100 (40%), Positives = 62/100 (62%) Frame = -3 Query: 301 AYGSLDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEI 122 A + L DV A K+ +R+S S + + +++TPR+ +T AL+K+A +G L GE+ Sbjct: 120 AADEIGLPDVDADAKPEKEHMNRVSDSILLKAMLETPRHEVTKALEKWANDGNVLDRGEL 179 Query: 121 SIAMLNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 +LNLRKRR + ALQ +EW+E K +E +RDY S + Sbjct: 180 FFVLLNLRKRRWFGKALQLLEWVEESKLLEFVERDYASRV 219 >gb|ESW17930.1| hypothetical protein PHAVU_007G280400g [Phaseolus vulgaris] Length = 602 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/99 (41%), Positives = 62/99 (62%) Frame = -3 Query: 298 YGSLDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEIS 119 + L+L D + ++ KK R + S +F+ I++ P S+ SAL+K+ E+GK L EI Sbjct: 113 HDELELSDAE-TDPTKKKSPGRQTQSELFKAIVNAPGLSIDSALNKWVEQGKELSRKEIM 171 Query: 118 IAMLNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 +AM NLRKR++Y A Q +WLE+ KK+E + DY S L Sbjct: 172 LAMRNLRKRKMYGRAFQLFQWLESNKKLEFVESDYASKL 210 >ref|XP_004162629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Cucumis sativus] Length = 608 Score = 79.3 bits (194), Expect = 5e-13 Identities = 42/84 (50%), Positives = 53/84 (63%) Frame = -3 Query: 253 AKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMA 74 A+K S+ S +F I S+ SALDK+ EGK L EIS+AML+LRKRR++ A Sbjct: 132 AEKKSSKWRPSELFNAIWKASVLSVPSALDKWVSEGKDLSRAEISLAMLHLRKRRMFGKA 191 Query: 73 LQFVEWLEARKKIELTDRDYVSHL 2 LQF EWLEA ++E RDY S L Sbjct: 192 LQFSEWLEANGQLEFNQRDYASRL 215 >ref|XP_002889301.1| hypothetical protein ARALYDRAFT_477224 [Arabidopsis lyrata subsp. lyrata] gi|297335142|gb|EFH65560.1| hypothetical protein ARALYDRAFT_477224 [Arabidopsis lyrata subsp. lyrata] Length = 597 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/74 (52%), Positives = 51/74 (68%) Frame = -3 Query: 223 SPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMALQFVEWLEAR 44 S +F+ I+ P S+ SALDK+ EEG + E++ AML LR+RR+Y ALQ EWLEA Sbjct: 131 SELFKTIVSAPGLSIGSALDKWVEEGNEITRVEVAKAMLQLRRRRMYGRALQLSEWLEAN 190 Query: 43 KKIELTDRDYVSHL 2 KKIE+ +RDY S L Sbjct: 191 KKIEMNERDYSSRL 204 >ref|XP_004303594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 625 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/74 (50%), Positives = 52/74 (70%) Frame = -3 Query: 223 SPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMALQFVEWLEAR 44 S +F+ I++ P S+ SALDK+ +EG L EIS+ +NLR+RR++ ALQ EWLEA Sbjct: 159 SALFKAILEFPGFSVHSALDKWVKEGNDLSRAEISLTKINLRRRRMFGRALQLSEWLEAH 218 Query: 43 KKIELTDRDYVSHL 2 K+IE ++RDY S L Sbjct: 219 KQIEFSERDYASRL 232 >ref|XP_003590264.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479312|gb|AES60515.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 557 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/96 (40%), Positives = 63/96 (65%) Frame = -3 Query: 289 LDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAM 110 L+L D + ++ KK +S S +F+ I+ S+ SALDK+ E+GK L EI +A+ Sbjct: 71 LELSDTE-TDSSDKKSFSSRRRSELFKAIVSVSGLSVDSALDKWVEKGKELSRQEIGLAL 129 Query: 109 LNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 +LR+R++Y ALQ ++WLE+ KK+E T+++Y S L Sbjct: 130 NSLRRRKMYGRALQALDWLESNKKLEFTEKEYASKL 165 >ref|XP_003590239.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479287|gb|AES60490.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 590 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/96 (40%), Positives = 63/96 (65%) Frame = -3 Query: 289 LDLVDVKASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAM 110 L+L D + ++ KK +S S +F+ I+ S+ SALDK+ E+GK L EI +A+ Sbjct: 120 LELSDTE-TDSSDKKSFSSRRRSELFKAIVSVSGLSVDSALDKWVEKGKELSRQEIGLAL 178 Query: 109 LNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 +LR+R++Y ALQ ++WLE+ KK+E T+++Y S L Sbjct: 179 NSLRRRKMYGRALQALDWLESNKKLEFTEKEYASKL 214 >ref|XP_003567340.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Brachypodium distachyon] Length = 612 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/101 (36%), Positives = 63/101 (62%), Gaps = 1/101 (0%) Frame = -3 Query: 301 AYGSLDLVDVK-ASEGGAKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGE 125 A ++DL++V A K+ ++S P+ +++++ P N ++ L K+ +G ++ + Sbjct: 119 AADAVDLLEVDDADSKSEKEPKKKISQCPLLKVMLEAPWNDVSGTLKKWVNDGNTVDRSD 178 Query: 124 ISIAMLNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 + A+LNLR+RR +S ALQ +EWLE K IEL +RDY S L Sbjct: 179 VFFAVLNLRRRRFFSKALQLLEWLEESKLIELVERDYASRL 219 >ref|XP_004162628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Cucumis sativus] Length = 613 Score = 76.6 bits (187), Expect = 3e-12 Identities = 42/99 (42%), Positives = 61/99 (61%), Gaps = 1/99 (1%) Frame = -3 Query: 295 GSLDLVDVKASEGGAKKGWS-RLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEIS 119 G+ + +D+ E G + S + + S + +I P +++SALDK+ EGK L +IS Sbjct: 121 GTQNELDLPEGETGLVEKISIKRAPSELLNVIWKAPGLTVSSALDKWVSEGKELSRDDIS 180 Query: 118 IAMLNLRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 AMLNLRK R+Y ALQF EWLEA K++ ++DY S L Sbjct: 181 SAMLNLRKCRMYGKALQFSEWLEANGKLDFVEKDYASRL 219 >gb|AFW79512.1| DNA-binding protein [Zea mays] Length = 622 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/77 (42%), Positives = 53/77 (68%) Frame = -3 Query: 232 LSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMALQFVEWL 53 LS S + + +++ PR+ +TSAL+K+A++G + GE+ +LNLRKR YS AL+ VEW+ Sbjct: 152 LSDSILLKTVLEAPRHQVTSALEKWAKDGNAFDRGELYYVLLNLRKRHWYSKALELVEWV 211 Query: 52 EARKKIELTDRDYVSHL 2 + + E +RDY +HL Sbjct: 212 QKSQLFEFVERDYAAHL 228 >gb|ADN33878.1| DNA-binding protein [Cucumis melo subsp. melo] Length = 470 Score = 76.3 bits (186), Expect = 4e-12 Identities = 43/94 (45%), Positives = 61/94 (64%), Gaps = 1/94 (1%) Frame = -3 Query: 280 VDVKASEGG-AKKGWSRLSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLN 104 +D+ E G A+K ++ + S +F +I P S+ SALDK+ EGK L +IS+ ML Sbjct: 111 LDLPEGETGLAEKISTKGAPSELFNIIWKAPGLSVPSALDKWVSEGKELSRADISLTMLY 170 Query: 103 LRKRRLYSMALQFVEWLEARKKIELTDRDYVSHL 2 LR+RR++ AL+F EWLEA K+ +TDRDY S L Sbjct: 171 LRRRRMFGKALKFSEWLEANGKL-VTDRDYASQL 203 >ref|NP_001147602.1| DNA-binding protein [Zea mays] gi|195612448|gb|ACG28054.1| DNA-binding protein [Zea mays] Length = 622 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/77 (42%), Positives = 53/77 (68%) Frame = -3 Query: 232 LSHSPIFQLIMDTPRNSLTSALDKYAEEGKSLGSGEISIAMLNLRKRRLYSMALQFVEWL 53 LS S + + +++ PR+ +TSAL+K+A++G + GE+ +LNLRKR YS AL+ VEW+ Sbjct: 152 LSDSILLKTVLEAPRHQVTSALEKWAKDGNAFDRGELYYVLLNLRKRHWYSKALELVEWV 211 Query: 52 EARKKIELTDRDYVSHL 2 + + E +RDY +HL Sbjct: 212 QKSQLFEFVERDYAAHL 228