BLASTX nr result
ID: Zingiber23_contig00022578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00022578 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus... 90 3e-16 gb|AFK49561.1| unknown [Lotus japonicus] 90 3e-16 ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citr... 90 4e-16 ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein... 90 4e-16 ref|XP_006346099.1| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 ref|XP_006857648.1| hypothetical protein AMTR_s00061p00142810 [A... 89 5e-16 ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 ref|XP_004244017.1| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 emb|CBI39826.3| unnamed protein product [Vitis vinifera] 89 5e-16 ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus pe... 89 8e-16 ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein... 89 8e-16 gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] 87 2e-15 gb|EOY11904.1| BTB/POZ domain-containing protein [Theobroma cacao] 87 2e-15 gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus lon... 86 4e-15 ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein... 86 5e-15 gb|ACL81160.1| BTB/POZ domain-containing protein [Mirabilis jalapa] 86 7e-15 ref|XP_003600432.1| Speckle-type POZ protein-like A [Medicago tr... 86 7e-15 ref|XP_002299061.1| BTB/POZ domain-containing family protein [Po... 85 9e-15 ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein... 85 1e-14 >gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] Length = 328 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETTPRLAQWRI+ L+ ++RKSDPFKIG WNW+L+VEKNR L VKL+ Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNWHLSVEKNRVLFVKLF 55 >gb|AFK49561.1| unknown [Lotus japonicus] Length = 328 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETTPRLAQWRI+ L+ ++RKSDPFKIG WNW+L+VEKNR L VKL+ Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNWHLSVEKNRVLFVKLF 55 >ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|568841705|ref|XP_006474798.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] gi|557555933|gb|ESR65947.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 328 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRV+TT RLAQWRID L+ S+RKSDPFKIG WNW+L++EKNR L VKLY Sbjct: 1 MSDSAYRVDTTSRLAQWRIDNLASCSYRKSDPFKIGKWNWHLSLEKNRMLFVKLY 55 >ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Glycine max] Length = 328 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETTPRLAQWRI+ L+ ++RKSDPFKIG WNW+L+VEKNR L VKL+ Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGNWNWHLSVEKNRVLFVKLF 55 >ref|XP_006346099.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Solanum tuberosum] Length = 328 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRV+TT RLAQWRID L+ ++RKSDPFKIG WNW+LAVEKNR L +KLY Sbjct: 1 MSDSAYRVDTTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLAVEKNRTLSIKLY 55 >ref|XP_006857648.1| hypothetical protein AMTR_s00061p00142810 [Amborella trichopoda] gi|548861744|gb|ERN19115.1| hypothetical protein AMTR_s00061p00142810 [Amborella trichopoda] Length = 331 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = +3 Query: 117 SERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 + +AYRVETTPRLAQWRI+ +S ++RKSDPFKIG WNWYL VE+NRQL +KL+ Sbjct: 4 NHQAYRVETTPRLAQWRIENISACTYRKSDPFKIGHWNWYLTVERNRQLYIKLF 57 >ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Fragaria vesca subsp. vesca] Length = 328 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETT RLAQWRID L+ ++RKSDPFKIG WNW+L+VEKN+ L+VKLY Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLSVEKNKVLVVKLY 55 >ref|XP_004244017.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Solanum lycopersicum] Length = 328 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRV+TT RLAQWRID L+ ++RKSDPFKIG WNW+LAVEKNR L +KLY Sbjct: 1 MSDSAYRVDTTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLAVEKNRTLSIKLY 55 >emb|CBI39826.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETT RLAQWRID L+ ++RKSDPFKIG WNW+L++EKNR L VKLY Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLSIEKNRTLSVKLY 55 >ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vitis vinifera] Length = 328 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETT RLAQWRID L+ ++RKSDPFKIG WNW+L++EKNR L VKLY Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLSIEKNRTLSVKLY 55 >gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] Length = 328 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETT RLAQWRID L+ ++RKSDPFKIG WNW+L++EKNR L VKLY Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKIGKWNWHLSLEKNRVLYVKLY 55 >ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X1 [Glycine max] Length = 328 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRV+TTPRLAQWRI+ L+ ++RKSDPFKIG WNW+L+VEKNR L VKL+ Sbjct: 1 MSDSAYRVQTTPRLAQWRIENLASCTYRKSDPFKIGNWNWHLSVEKNRVLFVKLF 55 >gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 328 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/55 (67%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 M++ AY+V+TTPRLAQWRI+ L+ ++RKSDPFKIG WNW+L+VEKN+ L VKLY Sbjct: 1 MTDSAYKVDTTPRLAQWRIENLASCTYRKSDPFKIGKWNWHLSVEKNKVLFVKLY 55 >gb|EOY11904.1| BTB/POZ domain-containing protein [Theobroma cacao] Length = 355 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MSE AYRVETT RLAQWRID + ++RKSDPFKIG WNW+L VE+NR L VKLY Sbjct: 1 MSESAYRVETTARLAQWRIDNFASCNYRKSDPFKIGKWNWHLLVERNRVLSVKLY 55 >gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus longan] Length = 328 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ AYRVETT RLAQWRID L+ ++RKSDPFKIG NW+LAVEKNR L +KLY Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKIGKRNWHLAVEKNRMLFIKLY 55 >ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] gi|449529700|ref|XP_004171836.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] Length = 327 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MSE AYRVETT RLAQWRI+ L+ ++RKSDPFKIG W W+L+VEKN+ L VKLY Sbjct: 1 MSESAYRVETTSRLAQWRIENLASCTYRKSDPFKIGKWKWHLSVEKNKLLYVKLY 55 >gb|ACL81160.1| BTB/POZ domain-containing protein [Mirabilis jalapa] Length = 332 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +3 Query: 129 YRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 YRV+TT RLAQWRID LS S+R+SDPF+IGLWNWYL VEK+R L++KLY Sbjct: 7 YRVDTTSRLAQWRIDNLSSCSYRRSDPFRIGLWNWYLVVEKSRVLVIKLY 56 >ref|XP_003600432.1| Speckle-type POZ protein-like A [Medicago truncatula] gi|355489480|gb|AES70683.1| Speckle-type POZ protein-like A [Medicago truncatula] Length = 330 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/55 (63%), Positives = 48/55 (87%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 M++ Y+V+TTPRLAQWRID L+ ++RKSDPFKIG+WNWYL+VEK++ + VKL+ Sbjct: 1 MTDSLYKVDTTPRLAQWRIDNLASCTYRKSDPFKIGIWNWYLSVEKHKVVFVKLF 55 >ref|XP_002299061.1| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|222846319|gb|EEE83866.1| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 330 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +3 Query: 126 AYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 AYRVETT RLAQW+ID L+ ++RKSDPFKIG WNW+L+VEKNR L VKLY Sbjct: 6 AYRVETTSRLAQWKIDNLASCTYRKSDPFKIGKWNWHLSVEKNRVLFVKLY 56 >ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cicer arietinum] Length = 330 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/55 (65%), Positives = 47/55 (85%) Frame = +3 Query: 114 MSERAYRVETTPRLAQWRIDTLSPFSFRKSDPFKIGLWNWYLAVEKNRQLLVKLY 278 MS+ Y+VETTPRLAQWRI+ L+ ++RKSDPFKIG WNWYL+VEK++ + VKL+ Sbjct: 1 MSDSVYKVETTPRLAQWRIENLASCTYRKSDPFKIGNWNWYLSVEKHKVVFVKLF 55