BLASTX nr result
ID: Zingiber23_contig00022570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00022570 (680 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ04888.1| hypothetical protein PRUPE_ppa026107mg, partial [... 61 4e-07 ref|XP_004289104.1| PREDICTED: probable dimethyladenosine transf... 60 5e-07 gb|EOX90955.1| Ribosomal RNA adenine dimethylase family protein ... 59 2e-06 ref|XP_006280630.1| hypothetical protein CARUB_v10026592mg [Caps... 58 2e-06 ref|XP_006425594.1| hypothetical protein CICLE_v10026231mg [Citr... 57 5e-06 >gb|EMJ04888.1| hypothetical protein PRUPE_ppa026107mg, partial [Prunus persica] Length = 344 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 7 AVQFKEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 138 A FKEK+ G+LKS +E KRPSKLSN + LHLL LFNQ GI F Sbjct: 282 ASSFKEKLMGVLKSADFEDKRPSKLSNEELLHLLALFNQAGIYF 325 >ref|XP_004289104.1| PREDICTED: probable dimethyladenosine transferase-like [Fragaria vesca subsp. vesca] Length = 375 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 7 AVQFKEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 138 A FKEK+ G+LKS +E KRPSKLSN + LHLL LFNQ GI F Sbjct: 317 ASSFKEKLIGVLKSADFENKRPSKLSNDELLHLLALFNQAGIYF 360 >gb|EOX90955.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao] Length = 389 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 16 FKEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 138 FKEKI GIL++ G+E KRPSKLSN + LHLL LFNQ GI F Sbjct: 329 FKEKIVGILRTGGFEDKRPSKLSNEELLHLLFLFNQAGIHF 369 >ref|XP_006280630.1| hypothetical protein CARUB_v10026592mg [Capsella rubella] gi|482549334|gb|EOA13528.1| hypothetical protein CARUB_v10026592mg [Capsella rubella] Length = 381 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +1 Query: 7 AVQFKEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 138 A FKE++ GIL++ G+E KRPSKLS+ + LHLL LFNQ GI F Sbjct: 325 ASMFKERVIGILRTNGFEEKRPSKLSHGELLHLLSLFNQAGIFF 368 >ref|XP_006425594.1| hypothetical protein CICLE_v10026231mg [Citrus clementina] gi|557527584|gb|ESR38834.1| hypothetical protein CICLE_v10026231mg [Citrus clementina] Length = 281 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +1 Query: 16 FKEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 138 FKEKI +LKS +E KRP KLSN + LHLL LFNQ GI F Sbjct: 212 FKEKITQVLKSAAFEDKRPCKLSNEELLHLLSLFNQVGIYF 252