BLASTX nr result
ID: Zingiber23_contig00020813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00020813 (242 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFS65103.1| uncharacterized protein, partial [Elaeis guineensis] 59 7e-07 >gb|AFS65103.1| uncharacterized protein, partial [Elaeis guineensis] Length = 246 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/60 (56%), Positives = 36/60 (60%), Gaps = 11/60 (18%) Frame = +2 Query: 95 SVMKSLEDEIGLPSP--APAHPETAVVV---------GQPDLGYLFEASDDELGLPPVAP 241 SVMK E+EI P P APA P+ V GQPDLGYL EASDDELGLPP P Sbjct: 90 SVMKIFEEEIAQPPPPPAPAAPDAVDPVFPPADFENLGQPDLGYLLEASDDELGLPPTVP 149