BLASTX nr result
ID: Zingiber23_contig00020616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00020616 (395 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828388.1| hypothetical protein AMTR_s00060p00016430 [A... 58 1e-06 >ref|XP_006828388.1| hypothetical protein AMTR_s00060p00016430 [Amborella trichopoda] gi|548833136|gb|ERM95804.1| hypothetical protein AMTR_s00060p00016430 [Amborella trichopoda] Length = 548 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 310 MGIEILALSLASPASQWERLSSSCQASTRSFIEMASLHLGASALS 176 MG+E+LALSL++PASQWER+SSS QASTR +EM + L S S Sbjct: 1 MGVEVLALSLSAPASQWERVSSSFQASTRGLVEMGTSELKVSHFS 45