BLASTX nr result
ID: Zingiber23_contig00020205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00020205 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632418.1| PREDICTED: squamosa promoter-binding-like pr... 72 8e-11 emb|CBI37021.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002273228.1| PREDICTED: squamosa promoter-binding-like pr... 72 8e-11 emb|CAN70646.1| hypothetical protein VITISV_006196 [Vitis vinifera] 72 8e-11 ref|XP_002311356.2| hypothetical protein POPTR_0008s09810g [Popu... 69 6e-10 ref|XP_002311354.1| predicted protein [Populus trichocarpa] 69 6e-10 ref|XP_006488745.1| PREDICTED: squamosa promoter-binding-like pr... 69 8e-10 ref|XP_006419255.1| hypothetical protein CICLE_v10004227mg [Citr... 69 8e-10 ref|XP_006419254.1| hypothetical protein CICLE_v10004227mg [Citr... 69 8e-10 ref|XP_006419250.1| hypothetical protein CICLE_v10004227mg [Citr... 69 8e-10 ref|XP_002302799.2| hypothetical protein POPTR_0002s18970g [Popu... 69 8e-10 ref|XP_002302800.1| predicted protein [Populus trichocarpa] 69 8e-10 ref|XP_002320264.2| hypothetical protein POPTR_0014s10960g [Popu... 67 2e-09 ref|XP_002320263.1| predicted protein [Populus trichocarpa] 67 2e-09 ref|XP_006378563.1| hypothetical protein POPTR_0010s16370g [Popu... 66 4e-09 ref|XP_002519316.1| Squamosa promoter-binding protein, putative ... 65 9e-09 gb|EOX95415.1| Squamosa promoter-binding protein, putative isofo... 64 2e-08 gb|EOX95414.1| Squamosa promoter-binding protein, putative isofo... 64 2e-08 ref|XP_004495872.1| PREDICTED: squamosa promoter-binding-like pr... 63 5e-08 ref|XP_006444595.1| hypothetical protein CICLE_v10018697mg [Citr... 62 1e-07 >ref|XP_003632418.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform 2 [Vitis vinifera] Length = 963 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA++G E + F +GTS+L ++GK++ EW+ N+W+WDG+LF A+P N PSD Sbjct: 1 MEAKIGGEAHHFYGIGTSDLRVVGKRSSEWDSNEWKWDGDLFIASPMNPVPSD 53 >emb|CBI37021.3| unnamed protein product [Vitis vinifera] Length = 860 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA++G E + F +GTS+L ++GK++ EW+ N+W+WDG+LF A+P N PSD Sbjct: 1 MEAKIGGEAHHFYGIGTSDLRVVGKRSSEWDSNEWKWDGDLFIASPMNPVPSD 53 >ref|XP_002273228.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform 1 [Vitis vinifera] Length = 997 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA++G E + F +GTS+L ++GK++ EW+ N+W+WDG+LF A+P N PSD Sbjct: 1 MEAKIGGEAHHFYGIGTSDLRVVGKRSSEWDSNEWKWDGDLFIASPMNPVPSD 53 >emb|CAN70646.1| hypothetical protein VITISV_006196 [Vitis vinifera] Length = 943 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA++G E + F +GTS+L ++GK++ EW+ N+W+WDG+LF A+P N PSD Sbjct: 1 MEAKIGGEAHHFYGIGTSDLRVVGKRSSEWDSNEWKWDGDLFIASPMNPVPSD 53 >ref|XP_002311356.2| hypothetical protein POPTR_0008s09810g [Populus trichocarpa] gi|550332747|gb|EEE88723.2| hypothetical protein POPTR_0008s09810g [Populus trichocarpa] Length = 1035 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA +G + F S+L +GK++LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEATIGGKSRHFYGPVVSDLKAVGKRSLEWDLNDWKWDGDLFKASPLNSAPSD 53 >ref|XP_002311354.1| predicted protein [Populus trichocarpa] Length = 202 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA +G + F S+L +GK++LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEATIGGKSRHFYGPVVSDLKAVGKRSLEWDLNDWKWDGDLFKASPLNSAPSD 53 >ref|XP_006488745.1| PREDICTED: squamosa promoter-binding-like protein 1-like isoform X1 [Citrus sinensis] gi|568871130|ref|XP_006488746.1| PREDICTED: squamosa promoter-binding-like protein 1-like isoform X2 [Citrus sinensis] gi|568871132|ref|XP_006488747.1| PREDICTED: squamosa promoter-binding-like protein 1-like isoform X3 [Citrus sinensis] Length = 1038 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA+ G + F S+L +GKK LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEAKFGGKVQNFYGPVVSDLKAVGKKTLEWDLNDWKWDGDLFTASPLNSAPSD 53 >ref|XP_006419255.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] gi|557521128|gb|ESR32495.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 1038 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA+ G + F S+L +GKK LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEAKFGGKVQNFYGPVVSDLKAVGKKTLEWDLNDWKWDGDLFTASPLNSAPSD 53 >ref|XP_006419254.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] gi|557521127|gb|ESR32494.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 907 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA+ G + F S+L +GKK LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEAKFGGKVQNFYGPVVSDLKAVGKKTLEWDLNDWKWDGDLFTASPLNSAPSD 53 >ref|XP_006419250.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] gi|557521123|gb|ESR32490.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 697 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA+ G + F S+L +GKK LEW+LNDW+WDG+LF A+P N+APSD Sbjct: 1 MEAKFGGKVQNFYGPVVSDLKAVGKKTLEWDLNDWKWDGDLFTASPLNSAPSD 53 >ref|XP_002302799.2| hypothetical protein POPTR_0002s18970g [Populus trichocarpa] gi|550345346|gb|EEE82072.2| hypothetical protein POPTR_0002s18970g [Populus trichocarpa] Length = 1002 Score = 68.6 bits (166), Expect = 8e-10 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPS 521 MEAR G E + F +G +++ +GK+ LEW+LNDW+WDG+LF A+P N PS Sbjct: 1 MEARFGGEPHHFYAMGPTDMRAVGKRGLEWDLNDWKWDGDLFIASPLNPVPS 52 >ref|XP_002302800.1| predicted protein [Populus trichocarpa] Length = 257 Score = 68.6 bits (166), Expect = 8e-10 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPS 521 MEAR G E + F +G +++ +GK+ LEW+LNDW+WDG+LF A+P N PS Sbjct: 1 MEARFGGEPHHFYAMGPTDMRAVGKRGLEWDLNDWKWDGDLFIASPLNPVPS 52 >ref|XP_002320264.2| hypothetical protein POPTR_0014s10960g [Populus trichocarpa] gi|550323958|gb|EEE98579.2| hypothetical protein POPTR_0014s10960g [Populus trichocarpa] Length = 1004 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPS 521 MEAR G E + F S++ +GK+ LEW+LNDW+WDG+LF A+P N PS Sbjct: 1 MEARFGGEAHHFYATPPSDMRTVGKRGLEWDLNDWKWDGDLFIASPLNPVPS 52 >ref|XP_002320263.1| predicted protein [Populus trichocarpa] Length = 257 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPS 521 MEAR G E + F S++ +GK+ LEW+LNDW+WDG+LF A+P N PS Sbjct: 1 MEARFGGEAHHFYATPPSDMRTVGKRGLEWDLNDWKWDGDLFIASPLNPVPS 52 >ref|XP_006378563.1| hypothetical protein POPTR_0010s16370g [Populus trichocarpa] gi|566191136|ref|XP_006378564.1| SQUAMOSA PROMOTER BINDING protein-LIKE 1 [Populus trichocarpa] gi|550329938|gb|ERP56360.1| hypothetical protein POPTR_0010s16370g [Populus trichocarpa] gi|550329939|gb|ERP56361.1| SQUAMOSA PROMOTER BINDING protein-LIKE 1 [Populus trichocarpa] Length = 1030 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA++G + S+L +GKK+LEW+LNDW+WDG+LF A P N+ PSD Sbjct: 1 MEAKMGGKSRHLYGPVLSDLKAVGKKSLEWDLNDWKWDGDLFTATPLNSVPSD 53 >ref|XP_002519316.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223541631|gb|EEF43180.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 1026 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/53 (49%), Positives = 38/53 (71%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEA+V + + F S++ GKK+L+W+LNDW+WDG+LF A+P N+ PSD Sbjct: 1 MEAKVRGKSHHFYGPVVSDMKAAGKKSLDWDLNDWKWDGDLFTASPLNSVPSD 53 >gb|EOX95415.1| Squamosa promoter-binding protein, putative isoform 2 [Theobroma cacao] Length = 982 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEAR GS+ + F + +NL +GK+ LEW+LNDW+WDG+LF A+ N +D Sbjct: 1 MEARFGSDAHHFYGMNPANLRAVGKRTLEWDLNDWKWDGDLFIASSINPVSAD 53 >gb|EOX95414.1| Squamosa promoter-binding protein, putative isoform 1 [Theobroma cacao] Length = 981 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEAR GS+ + F + +NL +GK+ LEW+LNDW+WDG+LF A+ N +D Sbjct: 1 MEARFGSDAHHFYGMNPANLRAVGKRTLEWDLNDWKWDGDLFIASSINPVSAD 53 >ref|XP_004495872.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform X1 [Cicer arietinum] gi|502117593|ref|XP_004495873.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform X2 [Cicer arietinum] gi|502117597|ref|XP_004495874.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform X3 [Cicer arietinum] Length = 1014 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +3 Query: 366 MEARVGSEGNRFLTVG-TSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 MEAR+G E F VG +S+LS M +++ EWNLNDWRWDG+LF AN N +D Sbjct: 1 MEARLGDEAYHFYGVGGSSDLSGMRRRSGEWNLNDWRWDGDLFIANRVNPVSAD 54 >ref|XP_006444595.1| hypothetical protein CICLE_v10018697mg [Citrus clementina] gi|557546857|gb|ESR57835.1| hypothetical protein CICLE_v10018697mg [Citrus clementina] Length = 988 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = +3 Query: 366 MEARVGSEGNRFLTVGTSNLSIMGKKNLEWNLNDWRWDGELFAANPANAAPSD 524 ME R E + F + + +L +GKK LEW+LNDW+WDG+LF A+ N AP++ Sbjct: 1 METRFRGEAHHFYGMNSMDLRAVGKKTLEWDLNDWKWDGDLFIASKLNPAPNE 53