BLASTX nr result
ID: Zingiber23_contig00018915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00018915 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619696.1| 18.2 kDa class I heat shock protein [Medicag... 57 3e-06 ref|NP_172220.1| class I heat shock protein [Arabidopsis thalian... 56 6e-06 ref|NP_176195.1| HSP20-like chaperone [Arabidopsis thaliana] gi|... 56 6e-06 ref|XP_006488422.1| PREDICTED: 18.5 kDa class I heat shock prote... 56 6e-06 ref|XP_006424968.1| hypothetical protein CICLE_v10029428mg [Citr... 56 6e-06 ref|XP_006424967.1| hypothetical protein CICLE_v10029437mg [Citr... 56 6e-06 ref|XP_006424966.1| hypothetical protein CICLE_v10029445mg [Citr... 56 6e-06 ref|XP_006424963.1| hypothetical protein CICLE_v10029453mg [Citr... 56 6e-06 ref|XP_004516546.1| PREDICTED: 18.5 kDa class I heat shock prote... 56 6e-06 ref|XP_006302970.1| hypothetical protein CARUB_v10021109mg [Caps... 56 6e-06 gb|AAC01560.1| heat shock protein 16.5 [Agrostis stolonifera var... 56 6e-06 gb|ABW89472.1| low molecular weight heat shock protein [Gossypiu... 56 6e-06 gb|AAM64758.1| heat shock protein, putative [Arabidopsis thaliana] 56 6e-06 ref|NP_200780.1| heat shock protein 18.2 [Arabidopsis thaliana] ... 55 7e-06 gb|EOY34199.1| HSP20-like chaperones superfamily protein [Theobr... 55 7e-06 ref|XP_006281238.1| hypothetical protein CARUB_v10027281mg [Caps... 55 7e-06 gb|EMT00253.1| hypothetical protein F775_08697 [Aegilops tauschii] 55 7e-06 ref|XP_002864649.1| heat shock protein 18 [Arabidopsis lyrata su... 55 7e-06 gb|ABW81098.1| HSP21 [Cleome spinosa] 55 7e-06 emb|CAB90693.1| heat shock protein 17a.12 [Quercus suber] 55 7e-06 >ref|XP_003619696.1| 18.2 kDa class I heat shock protein [Medicago truncatula] gi|355494711|gb|AES75914.1| 18.2 kDa class I heat shock protein [Medicago truncatula] Length = 159 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 R+DWKET EA VFKADLPGL+KE+VKVE+ G V Sbjct: 53 RIDWKETPEAHVFKADLPGLKKEEVKVEIEGDRV 86 >ref|NP_172220.1| class I heat shock protein [Arabidopsis thaliana] gi|75311415|sp|Q9LNW0.1|HS178_ARATH RecName: Full=17.8 kDa class I heat shock protein; AltName: Full=17.8 kDa heat shock protein; Short=AtHsp17.8 gi|8778561|gb|AAF79569.1|AC022464_27 F22G5.25 [Arabidopsis thaliana] gi|21555637|gb|AAM63903.1| heat shock protein, putative [Arabidopsis thaliana] gi|26452709|dbj|BAC43437.1| putative heat shock protein [Arabidopsis thaliana] gi|28973039|gb|AAO63844.1| putative heat shock protein [Arabidopsis thaliana] gi|332189999|gb|AEE28120.1| class I heat shock protein [Arabidopsis thaliana] Length = 157 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG++KE+VKVE+ SV Sbjct: 49 RVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 82 >ref|NP_176195.1| HSP20-like chaperone [Arabidopsis thaliana] gi|75315310|sp|Q9XIE3.1|HS17A_ARATH RecName: Full=17.6 kDa class I heat shock protein 1; AltName: Full=17.6 kDa heat shock protein 1; Short=AtHsp17.6A gi|5080819|gb|AAD39328.1|AC007258_17 Putative Heat shock hsp20 protein [Arabidopsis thaliana] gi|51968438|dbj|BAD42911.1| unknown protein [Arabidopsis thaliana] gi|51968672|dbj|BAD43028.1| unknown protein [Arabidopsis thaliana] gi|88900414|gb|ABD57519.1| At1g59860 [Arabidopsis thaliana] gi|332195508|gb|AEE33629.1| HSP20-like chaperone [Arabidopsis thaliana] Length = 155 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG++KE+VKVE+ SV Sbjct: 47 RVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 80 >ref|XP_006488422.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Citrus sinensis] Length = 161 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVEV Sbjct: 55 RVDWKETPEAHVFKADLPGLRKEEVKVEV 83 >ref|XP_006424968.1| hypothetical protein CICLE_v10029428mg [Citrus clementina] gi|568870474|ref|XP_006488427.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Citrus sinensis] gi|557526902|gb|ESR38208.1| hypothetical protein CICLE_v10029428mg [Citrus clementina] Length = 163 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVEV Sbjct: 56 RVDWKETPEAHVFKADLPGLRKEEVKVEV 84 >ref|XP_006424967.1| hypothetical protein CICLE_v10029437mg [Citrus clementina] gi|568870472|ref|XP_006488426.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Citrus sinensis] gi|557526901|gb|ESR38207.1| hypothetical protein CICLE_v10029437mg [Citrus clementina] Length = 162 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVEV Sbjct: 55 RVDWKETPEAHVFKADLPGLRKEEVKVEV 83 >ref|XP_006424966.1| hypothetical protein CICLE_v10029445mg [Citrus clementina] gi|557526900|gb|ESR38206.1| hypothetical protein CICLE_v10029445mg [Citrus clementina] Length = 161 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVEV Sbjct: 55 RVDWKETPEAHVFKADLPGLRKEEVKVEV 83 >ref|XP_006424963.1| hypothetical protein CICLE_v10029453mg [Citrus clementina] gi|568870470|ref|XP_006488425.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Citrus sinensis] gi|557526897|gb|ESR38203.1| hypothetical protein CICLE_v10029453mg [Citrus clementina] Length = 161 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVEV Sbjct: 55 RVDWKETPEAHVFKADLPGLRKEEVKVEV 83 >ref|XP_004516546.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGL+KEDVKVE+ Sbjct: 54 RVDWKETPEAHVFKADLPGLKKEDVKVEI 82 >ref|XP_006302970.1| hypothetical protein CARUB_v10021109mg [Capsella rubella] gi|482571680|gb|EOA35868.1| hypothetical protein CARUB_v10021109mg [Capsella rubella] Length = 148 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG++KE+VKVE+ SV Sbjct: 41 RVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 74 >gb|AAC01560.1| heat shock protein 16.5 [Agrostis stolonifera var. palustris] Length = 150 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 R+DWKET EA VFKADLPG++KE+VKVEV G +V Sbjct: 45 RMDWKETPEAHVFKADLPGVKKEEVKVEVEGGNV 78 >gb|ABW89472.1| low molecular weight heat shock protein [Gossypium hirsutum] Length = 159 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG++KE+VKVE+ G V Sbjct: 53 RVDWKETPEAHVFKADLPGVKKEEVKVEIEGDRV 86 >gb|AAM64758.1| heat shock protein, putative [Arabidopsis thaliana] Length = 155 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG++KE+VKVE+ SV Sbjct: 47 RVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 80 >ref|NP_200780.1| heat shock protein 18.2 [Arabidopsis thaliana] gi|123551|sp|P19037.1|HS181_ARATH RecName: Full=18.1 kDa class I heat shock protein; AltName: Full=18.1 kDa heat shock protein; Short=AtHsp18.1 gi|16344|emb|CAA35183.1| unnamed protein product [Arabidopsis thaliana] gi|9758837|dbj|BAB09509.1| 18.2 kD class I heat shock protein (HSP 18.2) [Arabidopsis thaliana] gi|17979311|gb|AAL49881.1| putative heat shock protein 18 [Arabidopsis thaliana] gi|21689719|gb|AAM67481.1| putative heat shock protein 18 [Arabidopsis thaliana] gi|110736992|dbj|BAF00451.1| heat shock protein 18 [Arabidopsis thaliana] gi|332009840|gb|AED97223.1| heat shock protein 18.2 [Arabidopsis thaliana] Length = 161 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPGL+KE+VKVEV +V Sbjct: 53 RVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNV 86 >gb|EOY34199.1| HSP20-like chaperones superfamily protein [Theobroma cacao] Length = 158 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEV 89 RVDWKET EA VFKADLPGLRKE+VKVE+ Sbjct: 52 RVDWKETPEAHVFKADLPGLRKEEVKVEI 80 >ref|XP_006281238.1| hypothetical protein CARUB_v10027281mg [Capsella rubella] gi|482549942|gb|EOA14136.1| hypothetical protein CARUB_v10027281mg [Capsella rubella] Length = 159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPGL+KE+VKVEV +V Sbjct: 53 RVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNV 86 >gb|EMT00253.1| hypothetical protein F775_08697 [Aegilops tauschii] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPG+RKE+VKVEV +V Sbjct: 47 RVDWKETPEAHVFKADLPGVRKEEVKVEVEDGNV 80 >ref|XP_002864649.1| heat shock protein 18 [Arabidopsis lyrata subsp. lyrata] gi|297310484|gb|EFH40908.1| heat shock protein 18 [Arabidopsis lyrata subsp. lyrata] Length = 160 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSV 104 RVDWKET EA VFKADLPGL+KE+VKVEV +V Sbjct: 53 RVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNV 86 >gb|ABW81098.1| HSP21 [Cleome spinosa] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSVPEKSLSSIVAEASGTTLPR 161 RVDW+ET EA VFKADLPG++KE+VKVE+ SV + S V E T R Sbjct: 48 RVDWRETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEEDKSDTWHR 100 >emb|CAB90693.1| heat shock protein 17a.12 [Quercus suber] Length = 110 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 3 RVDWKETREARVFKADLPGLRKEDVKVEVGGSSVPEKS 116 R+DWKET EA +FKADLPGL+KE+VKVEV +V + S Sbjct: 31 RIDWKETPEAHIFKADLPGLKKEEVKVEVEDGNVSQIS 68