BLASTX nr result
ID: Zingiber23_contig00018382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00018382 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89392.1| Auxin efflux carrier component 3 [Morus notabilis] 69 5e-10 dbj|BAO49658.1| putative auxin efflux carrier protein [Vigna ang... 69 5e-10 ref|XP_006644425.1| PREDICTED: LOW QUALITY PROTEIN: probable aux... 69 5e-10 ref|XP_006605369.1| PREDICTED: uncharacterized protein LOC100802... 69 5e-10 ref|XP_006605368.1| PREDICTED: uncharacterized protein LOC100802... 69 5e-10 ref|XP_006583898.1| PREDICTED: auxin efflux carrier component 3-... 69 5e-10 ref|XP_006469168.1| PREDICTED: auxin efflux carrier component 3-... 69 5e-10 ref|XP_006360412.1| PREDICTED: auxin efflux carrier component 3-... 69 5e-10 ref|XP_006344239.1| PREDICTED: auxin efflux carrier component 3-... 69 5e-10 ref|XP_002314810.2| PIN1-like family protein [Populus trichocarp... 69 5e-10 gb|EPS57138.1| hypothetical protein M569_17684, partial [Genlise... 69 5e-10 gb|EOY00957.1| Auxin efflux facilitator isoform 2 [Theobroma cacao] 69 5e-10 gb|EOY00956.1| Auxin efflux carrier family protein isoform 1 [Th... 69 5e-10 ref|XP_004498307.1| PREDICTED: auxin efflux carrier component 3-... 69 5e-10 ref|NP_001276316.1| uncharacterized protein LOC100785146 [Glycin... 69 5e-10 gb|AGJ95053.1| PIN1a [Glycine max] 69 5e-10 gb|EMJ28166.1| hypothetical protein PRUPE_ppa002528mg [Prunus pe... 69 5e-10 gb|AGG79243.1| auxin efflux facilitator PIN3b [Nicotiana tabacum] 69 5e-10 gb|AGG79242.1| auxin efflux facilitator PIN4 [Nicotiana tabacum] 69 5e-10 gb|AGG79240.1| auxin efflux facilitator PIN3 [Nicotiana tabacum] 69 5e-10 >gb|EXB89392.1| Auxin efflux carrier component 3 [Morus notabilis] Length = 652 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 609 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 641 >dbj|BAO49658.1| putative auxin efflux carrier protein [Vigna angularis] Length = 636 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 593 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 625 >ref|XP_006644425.1| PREDICTED: LOW QUALITY PROTEIN: probable auxin efflux carrier component 3a-like [Oryza brachyantha] Length = 616 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 573 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 605 >ref|XP_006605369.1| PREDICTED: uncharacterized protein LOC100802247 isoform X2 [Glycine max] Length = 654 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 611 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 643 >ref|XP_006605368.1| PREDICTED: uncharacterized protein LOC100802247 isoform X1 [Glycine max] Length = 664 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 621 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 653 >ref|XP_006583898.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Glycine max] Length = 662 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 619 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 651 >ref|XP_006469168.1| PREDICTED: auxin efflux carrier component 3-like [Citrus sinensis] Length = 657 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 614 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 646 >ref|XP_006360412.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum] Length = 622 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 579 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 611 >ref|XP_006344239.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum] Length = 654 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 611 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 643 >ref|XP_002314810.2| PIN1-like family protein [Populus trichocarpa] gi|550329637|gb|EEF00981.2| PIN1-like family protein [Populus trichocarpa] Length = 634 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 591 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 623 >gb|EPS57138.1| hypothetical protein M569_17684, partial [Genlisea aurea] Length = 134 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 91 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 123 >gb|EOY00957.1| Auxin efflux facilitator isoform 2 [Theobroma cacao] Length = 649 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 606 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 638 >gb|EOY00956.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 697 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 654 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 686 >ref|XP_004498307.1| PREDICTED: auxin efflux carrier component 3-like [Cicer arietinum] Length = 633 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 590 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 622 >ref|NP_001276316.1| uncharacterized protein LOC100785146 [Glycine max] gi|481044544|gb|AGJ95054.1| PIN3a [Glycine max] Length = 650 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 607 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 639 >gb|AGJ95053.1| PIN1a [Glycine max] Length = 561 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 518 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 550 >gb|EMJ28166.1| hypothetical protein PRUPE_ppa002528mg [Prunus persica] Length = 662 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 619 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 651 >gb|AGG79243.1| auxin efflux facilitator PIN3b [Nicotiana tabacum] Length = 619 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 576 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 608 >gb|AGG79242.1| auxin efflux facilitator PIN4 [Nicotiana tabacum] Length = 650 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 607 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 639 >gb|AGG79240.1| auxin efflux facilitator PIN3 [Nicotiana tabacum] Length = 620 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 99 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP Sbjct: 577 PQGIVPFVFAKEYNVHPAILSTAVIFGMLIALP 609