BLASTX nr result
ID: Zingiber23_contig00018251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00018251 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFI74270.1| linker histone H1 [Musa acuminata AAA Group] 58 1e-06 >gb|AFI74270.1| linker histone H1 [Musa acuminata AAA Group] Length = 315 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 140 PRRTSAHPPYAEMIKEAILTLKERTGSSPYAI 235 PR+ SAHPPYAEMI EAI+TLKERTGSS YAI Sbjct: 67 PRKPSAHPPYAEMIMEAIVTLKERTGSSQYAI 98