BLASTX nr result
ID: Zingiber23_contig00018073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00018073 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004952864.1| PREDICTED: uncharacterized protein LOC101761... 60 2e-07 ref|XP_004952863.1| PREDICTED: uncharacterized protein LOC101761... 60 2e-07 ref|XP_002307088.2| hypothetical protein POPTR_0005s07750g [Popu... 60 3e-07 ref|XP_006355350.1| PREDICTED: uncharacterized protein LOC102587... 59 5e-07 ref|XP_004237394.1| PREDICTED: uncharacterized protein LOC101260... 59 5e-07 ref|XP_004143468.1| PREDICTED: uncharacterized protein LOC101209... 59 5e-07 gb|EMJ06832.1| hypothetical protein PRUPE_ppa009210mg [Prunus pe... 59 7e-07 gb|EPS71861.1| hypothetical protein M569_02899 [Genlisea aurea] 59 9e-07 gb|EXC06729.1| hypothetical protein L484_021568 [Morus notabilis] 58 1e-06 ref|XP_006397478.1| hypothetical protein EUTSA_v10001828mg [Eutr... 58 1e-06 ref|XP_006828502.1| hypothetical protein AMTR_s00060p00180440 [A... 58 1e-06 ref|XP_006304203.1| hypothetical protein CARUB_v10010291mg [Caps... 58 1e-06 ref|NP_564463.1| uncharacterized protein [Arabidopsis thaliana] ... 58 1e-06 ref|XP_002893904.1| hypothetical protein ARALYDRAFT_473698 [Arab... 58 1e-06 ref|XP_002285798.1| PREDICTED: uncharacterized protein LOC100260... 58 1e-06 ref|XP_002285797.1| PREDICTED: uncharacterized protein LOC100260... 58 1e-06 ref|XP_002285796.1| PREDICTED: uncharacterized protein LOC100260... 58 1e-06 ref|XP_006657979.1| PREDICTED: uncharacterized protein LOC102718... 58 1e-06 ref|XP_006647410.1| PREDICTED: uncharacterized protein LOC102703... 58 1e-06 ref|XP_006411784.1| hypothetical protein EUTSA_v10024527mg [Eutr... 58 1e-06 >ref|XP_004952864.1| PREDICTED: uncharacterized protein LOC101761922 isoform X2 [Setaria italica] Length = 237 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 +IFADGK ASRDYFGGVRKPPGGESSIALV Sbjct: 208 NIFADGKVASRDYFGGVRKPPGGESSIALV 237 >ref|XP_004952863.1| PREDICTED: uncharacterized protein LOC101761922 isoform X1 [Setaria italica] Length = 238 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 +IFADGK ASRDYFGGVRKPPGGESSIALV Sbjct: 209 NIFADGKVASRDYFGGVRKPPGGESSIALV 238 >ref|XP_002307088.2| hypothetical protein POPTR_0005s07750g [Populus trichocarpa] gi|550338347|gb|EEE94084.2| hypothetical protein POPTR_0005s07750g [Populus trichocarpa] Length = 300 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK ASRDY GGVRKPPGGESSIALV Sbjct: 271 DIFADGKAASRDYLGGVRKPPGGESSIALV 300 >ref|XP_006355350.1| PREDICTED: uncharacterized protein LOC102587312 [Solanum tuberosum] Length = 310 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIF+DGK SRDYFGGVRKPPGGESSIALV Sbjct: 281 DIFSDGKVESRDYFGGVRKPPGGESSIALV 310 >ref|XP_004237394.1| PREDICTED: uncharacterized protein LOC101260128 [Solanum lycopersicum] Length = 310 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIF+DGK SRDYFGGVRKPPGGESSIALV Sbjct: 281 DIFSDGKVESRDYFGGVRKPPGGESSIALV 310 >ref|XP_004143468.1| PREDICTED: uncharacterized protein LOC101209377 [Cucumis sativus] gi|449504822|ref|XP_004162304.1| PREDICTED: uncharacterized protein LOC101230134 [Cucumis sativus] Length = 299 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDYFGGVRKPPGGES+IALV Sbjct: 270 DIFADGKAESRDYFGGVRKPPGGESTIALV 299 >gb|EMJ06832.1| hypothetical protein PRUPE_ppa009210mg [Prunus persica] Length = 302 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK +SRDY GGVRKPPGGESSIALV Sbjct: 273 DIFADGKASSRDYLGGVRKPPGGESSIALV 302 >gb|EPS71861.1| hypothetical protein M569_02899 [Genlisea aurea] Length = 291 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 +IFADGK SRDYFGGVRKPPGGESSIALV Sbjct: 262 NIFADGKVESRDYFGGVRKPPGGESSIALV 291 >gb|EXC06729.1| hypothetical protein L484_021568 [Morus notabilis] Length = 296 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GGVRKPPGGESSIALV Sbjct: 267 DIFADGKVESRDYLGGVRKPPGGESSIALV 296 >ref|XP_006397478.1| hypothetical protein EUTSA_v10001828mg [Eutrema salsugineum] gi|557098544|gb|ESQ38931.1| hypothetical protein EUTSA_v10001828mg [Eutrema salsugineum] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFAD K SRDYFGGVRKPPGGESSIALV Sbjct: 257 DIFADAKAQSRDYFGGVRKPPGGESSIALV 286 >ref|XP_006828502.1| hypothetical protein AMTR_s00060p00180440 [Amborella trichopoda] gi|548833250|gb|ERM95918.1| hypothetical protein AMTR_s00060p00180440 [Amborella trichopoda] Length = 307 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GGVRKPPGGESSIALV Sbjct: 278 DIFADGKAQSRDYLGGVRKPPGGESSIALV 307 >ref|XP_006304203.1| hypothetical protein CARUB_v10010291mg [Capsella rubella] gi|482572914|gb|EOA37101.1| hypothetical protein CARUB_v10010291mg [Capsella rubella] Length = 212 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFAD K SRDYFGGVRKPPGGESSIALV Sbjct: 183 DIFADAKAQSRDYFGGVRKPPGGESSIALV 212 >ref|NP_564463.1| uncharacterized protein [Arabidopsis thaliana] gi|8778973|gb|AAF79888.1|AC021198_8 Contains strong similarity to an unknown protein AAF18549 gi|6587863 from Arabidopsis thaliana BAC T11I11 gb|AC012680. ESTs gb|T21030, gb|Z18220, gb|T88048 and gb|AI997737 come from this gene [Arabidopsis thaliana] gi|16226792|gb|AAL16263.1|AF428333_1 At1g35780/F14D7_9 [Arabidopsis thaliana] gi|17380892|gb|AAL36258.1| unknown protein [Arabidopsis thaliana] gi|21689673|gb|AAM67458.1| unknown protein [Arabidopsis thaliana] gi|332193707|gb|AEE31828.1| uncharacterized protein AT1G35780 [Arabidopsis thaliana] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFAD K SRDYFGGVRKPPGGESSIALV Sbjct: 257 DIFADAKAQSRDYFGGVRKPPGGESSIALV 286 >ref|XP_002893904.1| hypothetical protein ARALYDRAFT_473698 [Arabidopsis lyrata subsp. lyrata] gi|297339746|gb|EFH70163.1| hypothetical protein ARALYDRAFT_473698 [Arabidopsis lyrata subsp. lyrata] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFAD K SRDYFGGVRKPPGGESSIALV Sbjct: 257 DIFADAKAQSRDYFGGVRKPPGGESSIALV 286 >ref|XP_002285798.1| PREDICTED: uncharacterized protein LOC100260886 isoform 3 [Vitis vinifera] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GGVRKPPGGESSIALV Sbjct: 257 DIFADGKAESRDYLGGVRKPPGGESSIALV 286 >ref|XP_002285797.1| PREDICTED: uncharacterized protein LOC100260886 isoform 2 [Vitis vinifera] Length = 304 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GGVRKPPGGESSIALV Sbjct: 275 DIFADGKAESRDYLGGVRKPPGGESSIALV 304 >ref|XP_002285796.1| PREDICTED: uncharacterized protein LOC100260886 isoform 1 [Vitis vinifera] gi|147861247|emb|CAN81471.1| hypothetical protein VITISV_020507 [Vitis vinifera] gi|302141947|emb|CBI19150.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GGVRKPPGGESSIALV Sbjct: 266 DIFADGKAESRDYLGGVRKPPGGESSIALV 295 >ref|XP_006657979.1| PREDICTED: uncharacterized protein LOC102718470 [Oryza brachyantha] Length = 288 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 DIFADGK SRDY GG+RKPPGGESSIALV Sbjct: 259 DIFADGKAPSRDYLGGIRKPPGGESSIALV 288 >ref|XP_006647410.1| PREDICTED: uncharacterized protein LOC102703279 [Oryza brachyantha] Length = 308 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV 91 +IFADGK ASRDYFGGVRKPPGG SSIALV Sbjct: 279 NIFADGKVASRDYFGGVRKPPGGGSSIALV 308 >ref|XP_006411784.1| hypothetical protein EUTSA_v10024527mg [Eutrema salsugineum] gi|557112954|gb|ESQ53237.1| hypothetical protein EUTSA_v10024527mg [Eutrema salsugineum] Length = 728 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 2 DIFADGKTASRDYFGGVRKPPGGESSIALV*LY 100 +IFADGK+ SRDYFGGVRKPPGGESSI+L+ L+ Sbjct: 268 NIFADGKSESRDYFGGVRKPPGGESSISLMSLF 300