BLASTX nr result
ID: Zingiber23_contig00016064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00016064 (671 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 80 6e-13 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 79 1e-12 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 77 6e-12 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 75 1e-11 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 75 1e-11 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 74 4e-11 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 73 7e-11 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 73 9e-11 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 73 9e-11 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 73 9e-11 ref|NP_001117603.1| conserved peptide upstream open reading fram... 73 9e-11 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 70 8e-10 ref|NP_001119115.1| conserved peptide upstream open reading fram... 70 8e-10 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 67 6e-09 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 66 8e-09 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 65 2e-08 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 63 7e-08 gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus... 62 1e-07 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 61 4e-07 ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809... 60 5e-07 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP+LSEIL SGFMINS+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP++SEIL SGFMINS+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 M+P++SE+LLSGF INSTLRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 375 SPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 SP++SEILLSGF INS+LRRRTHLVQSFSVVFL+WFYVFS Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP+LSEIL SGF+I+S+L+RRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MS ILSE LLSGF+INS+ RRRTHLVQSFS+VFLYWFYVFS Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVFS 41 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MS ILSE +LSGFMINSTLRR THLV SFSVVFLYWFYVFS Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVFS 41 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MS ILSE+ LSGFMINST RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP++ EI SGFMINSTLRRRTHLVQSFSVVFLYWFY+FS Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP++SEIL SG I+S+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP++SEIL SG I+S+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MS IL+E+ L GFMINST RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 69.7 bits (169), Expect = 8e-10 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -3 Query: 378 MSPI-LSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSPI LSEI LSGFM+NST+RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 MSP LSE+LLS MINST RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 M PILSEI SG MINST+RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 M ILSEI SG MINST+RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFY 265 M+P+L EILLSG + S L RRTHLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 256 M ILSE+ SG MINST+RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 378 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYV 262 M ILSEI SG MINST+RRRTHLVQSFSVVFLY F+V Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCFWV 39 >ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809564 [Glycine max] Length = 52 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 3/40 (7%) Frame = -3 Query: 366 LSEILLSGF---MINSTLRRRTHLVQSFSVVFLYWFYVFS 256 ++EI LS F MINS+ RRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MTEIPLSEFIRFMINSSFRRRTHLVQSFSVVFLYWFYVFS 40