BLASTX nr result
ID: Zingiber23_contig00016004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00016004 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY17758.1| Fatty acid desaturase 8 isoform 3, partial [Theob... 68 1e-09 gb|EOY17756.1| Fatty acid desaturase 8 isoform 1 [Theobroma caca... 68 1e-09 gb|AGQ56866.1| omega-3 fatty acid desaturase [Camellia sinensis] 67 3e-09 gb|EMS53345.1| Omega-3 fatty acid desaturase, chloroplastic [Tri... 64 3e-08 gb|EMJ19194.1| hypothetical protein PRUPE_ppa005645mg [Prunus pe... 63 4e-08 dbj|BAA11475.1| omega-3 fatty acid desaturase [Nicotiana tabacum... 63 4e-08 gb|ABU96743.1| chloroplast omega-3 fatty acid desaturase [Jatrop... 63 4e-08 gb|AAM77643.2|AF517831_1 chloroplast omega-3 desaturase [Prunus ... 63 4e-08 gb|EPS73562.1| hypothetical protein M569_01192, partial [Genlise... 62 6e-08 gb|EMT20695.1| Omega-3 fatty acid desaturase, chloroplastic [Aeg... 62 6e-08 dbj|BAA07785.3| plastid omega-3 fatty acid desaturase [Triticum ... 62 6e-08 dbj|BAJ93756.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 6e-08 emb|CBI25467.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002273774.1| PREDICTED: omega-3 fatty acid desaturase, ch... 62 6e-08 ref|XP_002323585.1| omega-3 desaturase family protein [Populus t... 62 8e-08 gb|ABK96470.1| unknown [Populus trichocarpa x Populus deltoides] 62 8e-08 gb|AGC51776.1| fatty acid desaturase [Manihot esculenta] 62 1e-07 ref|XP_004307659.1| PREDICTED: omega-3 fatty acid desaturase, ch... 61 1e-07 gb|AAS59833.1| chloroplast omega-3 desaturase [Malus domestica] 61 1e-07 dbj|BAA22440.1| fatty acid desaturase [Zea mays] gi|2447000|dbj|... 61 2e-07 >gb|EOY17758.1| Fatty acid desaturase 8 isoform 3, partial [Theobroma cacao] Length = 433 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHLFG+L+RSMKQDHYVSDTGD+VYY+TD QL S+++ Sbjct: 394 PFHLFGILVRSMKQDHYVSDTGDVVYYQTDPQLYGTSKSD 433 >gb|EOY17756.1| Fatty acid desaturase 8 isoform 1 [Theobroma cacao] gi|508725860|gb|EOY17757.1| Fatty acid desaturase 8 isoform 1 [Theobroma cacao] Length = 456 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHLFG+L+RSMKQDHYVSDTGD+VYY+TD QL S+++ Sbjct: 417 PFHLFGILVRSMKQDHYVSDTGDVVYYQTDPQLYGTSKSD 456 >gb|AGQ56866.1| omega-3 fatty acid desaturase [Camellia sinensis] Length = 452 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 P HL G L+RSMKQDHYVSDTGDIVYY+TD QLS + EAE Sbjct: 413 PLHLLGSLVRSMKQDHYVSDTGDIVYYQTDPQLSGSPEAE 452 >gb|EMS53345.1| Omega-3 fatty acid desaturase, chloroplastic [Triticum urartu] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEA 119 PFHLFG L RSMK DHYVSDTGDI+YY+TD +L+ ++A Sbjct: 252 PFHLFGALARSMKSDHYVSDTGDIIYYQTDPKLAGGAQA 290 >gb|EMJ19194.1| hypothetical protein PRUPE_ppa005645mg [Prunus persica] Length = 449 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/40 (72%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQL--SVASE 116 P HL GVL+RSMK+DHYVSDTGD+VYY+TD++L SV SE Sbjct: 410 PLHLLGVLIRSMKRDHYVSDTGDVVYYQTDKKLPGSVTSE 449 >dbj|BAA11475.1| omega-3 fatty acid desaturase [Nicotiana tabacum] gi|21668486|dbj|BAC01274.1| plastid omega-3 fatty acid desaturase [Nicotiana tabacum] Length = 441 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLS 104 PF+L GVL++SMKQDHYVSDTGDIVYY TD QLS Sbjct: 404 PFYLLGVLIKSMKQDHYVSDTGDIVYYRTDPQLS 437 >gb|ABU96743.1| chloroplast omega-3 fatty acid desaturase [Jatropha curcas] Length = 446 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLS 104 PFHL G L+RS+++DHYVSDTGD+VYY+TDRQLS Sbjct: 408 PFHLIGSLVRSLRKDHYVSDTGDVVYYQTDRQLS 441 >gb|AAM77643.2|AF517831_1 chloroplast omega-3 desaturase [Prunus persica] Length = 449 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/40 (72%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQL--SVASE 116 P HL GVL+RSMK+DHYVSDTGD+VYY+TD++L SV SE Sbjct: 410 PLHLLGVLIRSMKRDHYVSDTGDVVYYQTDKKLPGSVTSE 449 >gb|EPS73562.1| hypothetical protein M569_01192, partial [Genlisea aurea] Length = 351 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLS 104 PFHL G+LLRSM++DHYVSDTGDIVYY+TD +L+ Sbjct: 318 PFHLLGILLRSMRKDHYVSDTGDIVYYQTDPKLN 351 >gb|EMT20695.1| Omega-3 fatty acid desaturase, chloroplastic [Aegilops tauschii] Length = 371 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVAS 113 PFHLFG L RSMK DHYVSDTGDI+YY+TD +L+ + Sbjct: 331 PFHLFGALARSMKSDHYVSDTGDIIYYQTDPKLAAGA 367 >dbj|BAA07785.3| plastid omega-3 fatty acid desaturase [Triticum aestivum] Length = 381 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVAS 113 PFHLFG L RSMK DHYVSDTGDI+YY+TD +L+ + Sbjct: 341 PFHLFGALARSMKSDHYVSDTGDIIYYQTDPKLAAGA 377 >dbj|BAJ93756.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 438 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVAS 113 PFHLFG L RSMK DHYVSDTGDI+YY+TD +L+ + Sbjct: 398 PFHLFGALARSMKSDHYVSDTGDIIYYQTDPKLAAGA 434 >emb|CBI25467.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHL G L+RSMKQDHYVSDTGD+VYY+ D QL + ++E Sbjct: 410 PFHLLGSLIRSMKQDHYVSDTGDVVYYQKDPQLPGSQKSE 449 >ref|XP_002273774.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Vitis vinifera] Length = 456 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHL G L+RSMKQDHYVSDTGD+VYY+ D QL + ++E Sbjct: 417 PFHLLGSLIRSMKQDHYVSDTGDVVYYQKDPQLPGSQKSE 456 >ref|XP_002323585.1| omega-3 desaturase family protein [Populus trichocarpa] gi|222868215|gb|EEF05346.1| omega-3 desaturase family protein [Populus trichocarpa] Length = 452 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHL G L+RSM +DHYVSDTGD+VYY+TD Q+S +S E Sbjct: 413 PFHLIGDLIRSMARDHYVSDTGDVVYYQTDSQVSRSSSEE 452 >gb|ABK96470.1| unknown [Populus trichocarpa x Populus deltoides] Length = 452 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 PFHL G L+RSM +DHYVSDTGD+VYY+TD Q+S +S E Sbjct: 413 PFHLIGDLIRSMARDHYVSDTGDVVYYQTDSQVSRSSSEE 452 >gb|AGC51776.1| fatty acid desaturase [Manihot esculenta] Length = 453 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQL 101 PFHL G L+RSMKQDHYVSDTGD+VYY+TD L Sbjct: 414 PFHLLGSLIRSMKQDHYVSDTGDVVYYQTDSNL 446 >ref|XP_004307659.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 432 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLS 104 PFHL GVL++S K+DHYVSDTGD+VYY+TD+++S Sbjct: 397 PFHLLGVLVKSFKKDHYVSDTGDVVYYQTDKKIS 430 >gb|AAS59833.1| chloroplast omega-3 desaturase [Malus domestica] Length = 439 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASEAE 122 P HL GVL+RS K+DHYVSDTGD+VYY+TD++L+ ++ +E Sbjct: 400 PLHLLGVLVRSFKRDHYVSDTGDVVYYQTDKELAGSAVSE 439 >dbj|BAA22440.1| fatty acid desaturase [Zea mays] gi|2447000|dbj|BAA22442.1| fatty acid desaturase [Zea mays] Length = 398 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = +3 Query: 3 PFHLFGVLLRSMKQDHYVSDTGDIVYYETDRQLSVASE 116 P+HLFGVL +S+KQDHYVSDTGD+VYY+TD + + +++ Sbjct: 358 PWHLFGVLAQSLKQDHYVSDTGDVVYYQTDSKTNTSAQ 395