BLASTX nr result
ID: Zingiber23_contig00014578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014578 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305776.1| leucine-rich repeat receptor-like protein ki... 61 1e-07 ref|XP_002509423.1| protein with unknown function [Ricinus commu... 60 3e-07 ref|XP_002329803.1| predicted protein [Populus trichocarpa] gi|5... 60 3e-07 ref|XP_006470176.1| PREDICTED: receptor-like protein kinase 5-li... 59 5e-07 ref|XP_006446707.1| hypothetical protein CICLE_v10014127mg [Citr... 59 5e-07 emb|CBI30615.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002278698.1| PREDICTED: receptor-like protein kinase HSL1... 59 7e-07 emb|CAN77471.1| hypothetical protein VITISV_029764 [Vitis vinifera] 59 7e-07 gb|EXB54947.1| Receptor-like protein kinase HSL1 [Morus notabilis] 59 9e-07 ref|XP_004164018.1| PREDICTED: receptor-like protein kinase HSL1... 59 9e-07 ref|XP_006468213.1| PREDICTED: receptor-like protein kinase HSL1... 58 1e-06 ref|XP_003528467.1| PREDICTED: receptor-like protein kinase HSL1... 58 1e-06 gb|ESW31365.1| hypothetical protein PHAVU_002G232600g, partial [... 57 2e-06 ref|XP_004293793.1| PREDICTED: receptor-like protein kinase HSL1... 57 2e-06 gb|EMJ14893.1| hypothetical protein PRUPE_ppa000813mg [Prunus pe... 57 2e-06 gb|ABO61512.1| LRR receptor-like protein kinase m2 [Malus domest... 57 2e-06 gb|ABO61513.1| LRR receptor-like protein kinase m3 [Malus domest... 57 2e-06 gb|ABO61514.1| LRR receptor-like protein kinase m4 [Malus domest... 57 2e-06 gb|ESW20110.1| hypothetical protein PHAVU_006G181800g [Phaseolus... 57 3e-06 gb|EOX99531.1| HAESA-like 1 isoform 1 [Theobroma cacao] 57 3e-06 >ref|XP_002305776.1| leucine-rich repeat receptor-like protein kinase [Populus trichocarpa] gi|222848740|gb|EEE86287.1| leucine-rich repeat receptor-like protein kinase [Populus trichocarpa] Length = 992 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVKMLQE+ A+N KI K K + Y +D + GS A Sbjct: 940 LCTSPLPINRPSMRRVVKMLQEIGAENLSKIAKKDGKLTPYYYEDTSDHGSVA 992 >ref|XP_002509423.1| protein with unknown function [Ricinus communis] gi|223549322|gb|EEF50810.1| protein with unknown function [Ricinus communis] Length = 994 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVKMLQE+ +N PK K K + Y +D + GS A Sbjct: 942 LCTSPLPINRPSMRRVVKMLQEIRPENMPKAAKKDGKLTPYYYEDASDQGSVA 994 >ref|XP_002329803.1| predicted protein [Populus trichocarpa] gi|566193941|ref|XP_006377415.1| hypothetical protein POPTR_0011s05710g [Populus trichocarpa] gi|566193943|ref|XP_006377416.1| leucine-rich repeat receptor-like protein kinase [Populus trichocarpa] gi|550327704|gb|ERP55212.1| hypothetical protein POPTR_0011s05710g [Populus trichocarpa] gi|550327705|gb|ERP55213.1| leucine-rich repeat receptor-like protein kinase [Populus trichocarpa] Length = 992 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVKMLQE+ A N+ K K K + Y +D + GS A Sbjct: 940 LCTSPLPINRPSMRRVVKMLQEIGADNQSKTAKKDGKLTPYYFEDASDHGSVA 992 >ref|XP_006470176.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis] Length = 989 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDP 208 LCT++LP+NRPSMRKVVK+LQE A+NK K K K S Y +DP Sbjct: 937 LCTNALPLNRPSMRKVVKLLQEATAENKSKTIKKDGKLSPYYYEDP 982 >ref|XP_006446707.1| hypothetical protein CICLE_v10014127mg [Citrus clementina] gi|557549318|gb|ESR59947.1| hypothetical protein CICLE_v10014127mg [Citrus clementina] Length = 1023 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDP 208 LCT++LP+NRPSMRKVVK+LQE A+NK K K K S Y +DP Sbjct: 971 LCTNALPLNRPSMRKVVKLLQEATAENKSKTIKKDGKLSPYYYEDP 1016 >emb|CBI30615.3| unnamed protein product [Vitis vinifera] Length = 642 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGS 193 LCTS LPINRPSMR+VVKMLQ+V +N+PK K K S Y +D + GS Sbjct: 590 LCTSPLPINRPSMRRVVKMLQDVGGENQPKPVKKDGKLSPYYHEDASDQGS 640 >ref|XP_002278698.1| PREDICTED: receptor-like protein kinase HSL1-like [Vitis vinifera] Length = 989 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGS 193 LCTS LPINRPSMR+VVKMLQ+V +N+PK K K S Y +D + GS Sbjct: 937 LCTSPLPINRPSMRRVVKMLQDVGGENQPKPVKKDGKLSPYYHEDASDQGS 987 >emb|CAN77471.1| hypothetical protein VITISV_029764 [Vitis vinifera] Length = 953 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGS 193 LCTS LPINRPSMR+VVKMLQ+V +N+PK K K S Y +D + GS Sbjct: 901 LCTSPLPINRPSMRRVVKMLQDVGGENQPKPVKKDGKLSPYYHEDASDQGS 951 >gb|EXB54947.1| Receptor-like protein kinase HSL1 [Morus notabilis] Length = 992 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/52 (57%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKI-RKNGSKSSHCYLKDPIEFGS 193 LCT+SLPINRPSMRKVVKM+QE ++ N+ K RK+G S + Y +D + GS Sbjct: 939 LCTNSLPINRPSMRKVVKMIQEASSDNQSKSGRKDGKLSPYYYYEDASDQGS 990 >ref|XP_004164018.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus] Length = 1000 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMRKVVKMLQEV A+N+ K K + Y +D + GS A Sbjct: 948 LCTSPLPINRPSMRKVVKMLQEVGAENQLKSNSKDGKLTPYYYEDASDQGSVA 1000 >ref|XP_006468213.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis] Length = 1381 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRP+MR+VVK+LQEV A+N+ K K K S Y +D + GS A Sbjct: 950 LCTSPLPINRPAMRRVVKLLQEVGAENRSKTGKKDGKLSPYYHEDASDQGSVA 1002 >ref|XP_003528467.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max] Length = 1007 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGS 193 +CTS LPINRPSMR+VVKMLQEV+ +++ K K SK S Y D + GS Sbjct: 955 MCTSPLPINRPSMRRVVKMLQEVSTEDQTKPAKKDSKLSPYYYDDASDHGS 1005 >gb|ESW31365.1| hypothetical protein PHAVU_002G232600g, partial [Phaseolus vulgaris] Length = 1028 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGS 193 +CTS LP+NRPSMR+VVKMLQEV +N+ K K K S Y D + GS Sbjct: 976 MCTSPLPVNRPSMRRVVKMLQEVGTENQTKPAKKDGKLSPYYYDDASDHGS 1026 >ref|XP_004293793.1| PREDICTED: receptor-like protein kinase HSL1-like [Fragaria vesca subsp. vesca] Length = 993 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVK+LQE + P+I+K G K S Y +D + GS A Sbjct: 942 LCTSPLPINRPSMRRVVKLLQEAGTEKHPQIKKEG-KLSPYYYEDASDHGSVA 993 >gb|EMJ14893.1| hypothetical protein PRUPE_ppa000813mg [Prunus persica] Length = 995 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVK+LQEV + P+ K K S Y +D + GS A Sbjct: 943 LCTSPLPINRPSMRRVVKLLQEVGTEKHPQTAKKEGKLSPYYYEDTSDHGSVA 995 >gb|ABO61512.1| LRR receptor-like protein kinase m2 [Malus domestica] Length = 998 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVK+LQEV + P+ K K S Y +D + GS A Sbjct: 946 LCTSPLPINRPSMRRVVKLLQEVGTEKHPQAAKKEGKLSPYYYEDASDHGSVA 998 >gb|ABO61513.1| LRR receptor-like protein kinase m3 [Malus domestica] Length = 1001 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVK+LQEV + P+ K K S Y +D + GS A Sbjct: 949 LCTSPLPINRPSMRRVVKLLQEVGTEKHPQAAKKEGKLSPYYYEDASDHGSVA 1001 >gb|ABO61514.1| LRR receptor-like protein kinase m4 [Malus domestica] Length = 998 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 LCTS LPINRPSMR+VVK+LQEV + P+ K K S Y +D + GS A Sbjct: 946 LCTSPLPINRPSMRRVVKLLQEVGTEKHPQAAKKEGKLSPYYYEDASDHGSVA 998 >gb|ESW20110.1| hypothetical protein PHAVU_006G181800g [Phaseolus vulgaris] Length = 945 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFGSNA 187 +CTS LPINRP+MR+VVKMLQEV +N+ K K K S Y D + GS A Sbjct: 893 MCTSPLPINRPAMRRVVKMLQEVGTENQTKSAKKDGKLSPYYYDDGSDHGSVA 945 >gb|EOX99531.1| HAESA-like 1 isoform 1 [Theobroma cacao] Length = 1005 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -3 Query: 345 LCTSSLPINRPSMRKVVKMLQEVNAKNKPKIRKNGSKSSHCYLKDPIEFG 196 LCT++LPINRPSMRKVVK+LQE +NK K K+G S + Y ++ + G Sbjct: 942 LCTNALPINRPSMRKVVKLLQEAGGENKSKAGKDGKLSPYYYNEEASDQG 991