BLASTX nr result
ID: Zingiber23_contig00014479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014479 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003573706.1| PREDICTED: RNA-binding protein Musashi homol... 65 7e-09 emb|CBI39777.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002271592.1| PREDICTED: heterogeneous nuclear ribonucleop... 65 1e-08 gb|EOY11959.1| RNA-binding family protein [Theobroma cacao] 64 3e-08 ref|XP_004294926.1| PREDICTED: RNA-binding protein Musashi homol... 64 3e-08 gb|EPS72088.1| g-strand specific single-stranded telomere-bindin... 63 4e-08 gb|EMJ06525.1| hypothetical protein PRUPE_ppa006963mg [Prunus pe... 62 6e-08 gb|EXC21514.1| Heterogeneous nuclear ribonucleoprotein 27C [Moru... 62 8e-08 ref|XP_003574688.1| PREDICTED: nuclear polyadenylated RNA-bindin... 62 1e-07 ref|XP_002522793.1| Heterogeneous nuclear ribonucleoprotein A1, ... 62 1e-07 emb|CBI18525.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002277226.1| PREDICTED: RNA-binding protein Musashi homol... 61 1e-07 ref|XP_006474836.1| PREDICTED: heterogeneous nuclear ribonucleop... 61 2e-07 ref|XP_004973208.1| PREDICTED: heterogeneous nuclear ribonucleop... 60 2e-07 ref|XP_006659294.1| PREDICTED: heterogeneous nuclear ribonucleop... 60 3e-07 ref|XP_004243590.1| PREDICTED: DAZ-associated protein 1-like [So... 60 3e-07 ref|XP_004149406.1| PREDICTED: nuclear polyadenylated RNA-bindin... 60 3e-07 gb|ADN95985.1| G-strand specific single-stranded telomere-bindin... 60 4e-07 gb|EMT08125.1| RNA-binding Musashi-2-like protein [Aegilops taus... 59 5e-07 ref|XP_006368107.1| PREDICTED: heterogeneous nuclear ribonucleop... 59 7e-07 >ref|XP_003573706.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Brachypodium distachyon] Length = 347 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +2 Query: 23 LLAKKGNMIDLAGTKVEIKKAEPKKPGNPPPAFGSGSRSRHFGD 154 LLAKKGNMIDL GT+VEIKKAEPKKP NPP +F + RSR D Sbjct: 159 LLAKKGNMIDLDGTQVEIKKAEPKKPSNPPHSFDNKPRSRPHAD 202 >emb|CBI39777.3| unnamed protein product [Vitis vinifera] Length = 293 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 + KGNMID+AGT+VEIKKAEPKK NPP PA+GS SR+R F D Sbjct: 164 MISKGNMIDMAGTQVEIKKAEPKKASNPPPAPAYGSNSRARSFSD 208 >ref|XP_002271592.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 27C [Vitis vinifera] gi|147768836|emb|CAN78130.1| hypothetical protein VITISV_036088 [Vitis vinifera] Length = 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 + KGNMID+AGT+VEIKKAEPKK NPP PA+GS SR+R F D Sbjct: 164 MISKGNMIDMAGTQVEIKKAEPKKASNPPPAPAYGSNSRARSFSD 208 >gb|EOY11959.1| RNA-binding family protein [Theobroma cacao] Length = 348 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 L KGNMID+AGT+VEIKKAEPKK NPP PA+GS SR R + D Sbjct: 164 LLSKGNMIDMAGTQVEIKKAEPKKASNPPPAPAYGSNSRGRSYDD 208 >ref|XP_004294926.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Fragaria vesca subsp. vesca] Length = 353 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 L KGNMID+ GT+VEIKKAEPKK NPP PA+GS SR+R F D Sbjct: 163 LLSKGNMIDMEGTQVEIKKAEPKKSSNPPPAPAYGSNSRARSFND 207 >gb|EPS72088.1| g-strand specific single-stranded telomere-binding protein 1 [Genlisea aurea] Length = 350 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGN--PPPAFGSGSRSRHFGDN 157 L GNMID+AGT+VEIKKAEPKKP N P PA+GS SR R +GD+ Sbjct: 160 LLADGNMIDMAGTQVEIKKAEPKKPSNLPPAPAYGSDSRGRGYGDS 205 >gb|EMJ06525.1| hypothetical protein PRUPE_ppa006963mg [Prunus persica] Length = 388 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGN--PPPAFGSGSRSRHFGD 154 L KGNMID+AGT+VEIKKAEPKK N P PA+GS SR+R F D Sbjct: 202 LLSKGNMIDMAGTQVEIKKAEPKKASNPSPAPAYGSNSRARSFND 246 >gb|EXC21514.1| Heterogeneous nuclear ribonucleoprotein 27C [Morus notabilis] Length = 352 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 L KGNM+D+AGT+VEIKKAEPKK NPP PA+G SR+R F D Sbjct: 164 LLSKGNMVDIAGTQVEIKKAEPKKASNPPPAPAYGGISRARSFSD 208 >ref|XP_003574688.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like [Brachypodium distachyon] Length = 359 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPPPAFGSGSRSRHFGDN 157 L GNMIDLAG+KVEIKKAEPKK NPPP+ GS SRS + D+ Sbjct: 169 LLANGNMIDLAGSKVEIKKAEPKKSSNPPPSGGSDSRSAYSRDS 212 >ref|XP_002522793.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus communis] gi|223538031|gb|EEF39644.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus communis] Length = 348 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPPPA--FGSGSRSRHFGDN 157 + GNMID+AGT+VEIKKAEPKK NPPPA +GS SR R + D+ Sbjct: 164 MLSNGNMIDMAGTQVEIKKAEPKKASNPPPAPSYGSNSRGRSYNDS 209 >emb|CBI18525.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 + +GNMID+AGT+VEIKKAEPKK NPP AFGS SR+R F D Sbjct: 164 ILSEGNMIDMAGTQVEIKKAEPKKASNPPHVSAFGSNSRARSFSD 208 >ref|XP_002277226.1| PREDICTED: RNA-binding protein Musashi homolog 2 [Vitis vinifera] Length = 348 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNPP--PAFGSGSRSRHFGD 154 + +GNMID+AGT+VEIKKAEPKK NPP AFGS SR+R F D Sbjct: 164 ILSEGNMIDMAGTQVEIKKAEPKKASNPPHVSAFGSNSRARSFSD 208 >ref|XP_006474836.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Citrus sinensis] Length = 349 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGN--PPPAFGSGSRSRHFGD 154 + KGNMID+AGT+VEIKKAEPKK N PPP++ S SR R F D Sbjct: 164 MLSKGNMIDMAGTQVEIKKAEPKKSSNPPPPPSYASNSRGRSFND 208 >ref|XP_004973208.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Setaria italica] Length = 350 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +2 Query: 23 LLAKKGNMIDLAGTKVEIKKAEPKKPGNPPP-AFGSGSRSRHFGDN 157 LLAKKGNMIDL G++VEIKKAEPKKP NPPP + S R R + ++ Sbjct: 159 LLAKKGNMIDLNGSQVEIKKAEPKKPSNPPPRSLDSEPRGRPYAES 204 >ref|XP_006659294.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like [Oryza brachyantha] Length = 350 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +2 Query: 23 LLAKKGNMIDLAGTKVEIKKAEPKKPGNPPP-AFGSGSRSRHFGD 154 LLAKKGNMIDL G++VEIKKAEPKKP NPPP + S R R D Sbjct: 160 LLAKKGNMIDLNGSQVEIKKAEPKKPSNPPPRSIDSEPRGRPHAD 204 >ref|XP_004243590.1| PREDICTED: DAZ-associated protein 1-like [Solanum lycopersicum] Length = 343 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNP--PPAFGSGSRSRHFGDN 157 L +GN +D+ GT+VEIKKAEPKKP NP PA+GS SR R FGD+ Sbjct: 160 LLAEGNRMDMMGTQVEIKKAEPKKPSNPASAPAYGSNSRGRGFGDS 205 >ref|XP_004149406.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like [Cucumis sativus] gi|449496860|ref|XP_004160246.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like [Cucumis sativus] Length = 347 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGN--PPPAFGSGSRSRHFGD 154 + KGNMID++GT+VEIKKAEPKK N P PA+GS SR+R F D Sbjct: 164 ILSKGNMIDMSGTQVEIKKAEPKKSSNPLPAPAYGSNSRARTFND 208 >gb|ADN95985.1| G-strand specific single-stranded telomere-binding protein 3 [Nicotiana tabacum] Length = 339 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNP--PPAFGSGSRSRHFGDN 157 L +GN ID+ GT+VEIKKAEPKKP NP PA+GS SR R +GD+ Sbjct: 160 LLAEGNRIDMMGTQVEIKKAEPKKPSNPASAPAYGSDSRGRGYGDS 205 >gb|EMT08125.1| RNA-binding Musashi-2-like protein [Aegilops tauschii] Length = 367 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +2 Query: 23 LLAKKGNMIDLAGTKVEIKKAEPKKPGNPPPAFGSGSRSRHFGD 154 LLAKKGN IDL GT+VEIKKAEPKKP NPP + S R + D Sbjct: 133 LLAKKGNKIDLNGTQVEIKKAEPKKPSNPPHSLDSKPRRSPYAD 176 >ref|XP_006368107.1| PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like, partial [Solanum tuberosum] Length = 238 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +2 Query: 26 LAKKGNMIDLAGTKVEIKKAEPKKPGNP--PPAFGSGSRSRHFGDN 157 L +GN +D+ GT+VEIKKAEPKKP NP PA+GS SR R +GD+ Sbjct: 92 LLAEGNRMDMMGTQVEIKKAEPKKPSNPASAPAYGSNSRGRGYGDS 137