BLASTX nr result
ID: Zingiber23_contig00014408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014408 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006654514.1| PREDICTED: histone H2B.11-like [Oryza brachy... 100 3e-19 ref|XP_006649859.1| PREDICTED: histone H2B.1-like [Oryza brachya... 100 3e-19 ref|XP_004970520.1| PREDICTED: histone H2B.11-like [Setaria ital... 100 3e-19 ref|XP_004961843.1| PREDICTED: histone H2B.2-like [Setaria italica] 100 3e-19 sp|A2XF66.1|H2B1_ORYSI RecName: Full=Histone H2B.1 gi|152032513|... 100 3e-19 gb|ABF95290.1| Core histone H2A/H2B/H3/H4 family protein [Oryza ... 100 3e-19 gb|AAT68209.1| putative histone H2B [Cynodon dactylon] 100 3e-19 ref|NP_001044754.1| Os01g0839500 [Oryza sativa Japonica Group] g... 100 3e-19 ref|XP_002533106.1| histone h2b, putative [Ricinus communis] gi|... 99 6e-19 gb|EMT26655.1| Putative histone H2B.1 [Aegilops tauschii] 99 8e-19 gb|EMS49652.1| putative histone H2B.1 [Triticum urartu] 99 8e-19 ref|XP_003568303.1| PREDICTED: histone H2B.6-like [Brachypodium ... 99 8e-19 ref|XP_002439923.1| hypothetical protein SORBIDRAFT_09g022610 [S... 99 8e-19 gb|EOY33678.1| Histone superfamily protein [Theobroma cacao] 98 1e-18 ref|XP_003543443.1| PREDICTED: probable histone H2B.1-like [Glyc... 98 1e-18 ref|XP_003540207.1| PREDICTED: histone H2B.3 [Glycine max] 98 1e-18 ref|XP_002523734.1| histone h2b, putative [Ricinus communis] gi|... 98 1e-18 ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isofo... 98 1e-18 ref|XP_006349988.1| PREDICTED: histone H2B-like [Solanum tuberosum] 98 1e-18 ref|XP_006349986.1| PREDICTED: probable histone H2B.1-like [Sola... 98 1e-18 >ref|XP_006654514.1| PREDICTED: histone H2B.11-like [Oryza brachyantha] Length = 145 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 56 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 106 >ref|XP_006649859.1| PREDICTED: histone H2B.1-like [Oryza brachyantha] Length = 151 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 62 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 112 >ref|XP_004970520.1| PREDICTED: histone H2B.11-like [Setaria italica] Length = 139 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 50 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 100 >ref|XP_004961843.1| PREDICTED: histone H2B.2-like [Setaria italica] Length = 144 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 55 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 105 >sp|A2XF66.1|H2B1_ORYSI RecName: Full=Histone H2B.1 gi|152032513|sp|A3AGM4.1|H2B1_ORYSJ RecName: Full=Histone H2B.1 gi|125543337|gb|EAY89476.1| hypothetical protein OsI_11007 [Oryza sativa Indica Group] gi|125585799|gb|EAZ26463.1| hypothetical protein OsJ_10352 [Oryza sativa Japonica Group] Length = 152 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 63 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 113 >gb|ABF95290.1| Core histone H2A/H2B/H3/H4 family protein [Oryza sativa Japonica Group] Length = 417 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 63 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 113 >gb|AAT68209.1| putative histone H2B [Cynodon dactylon] Length = 98 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 9 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 59 >ref|NP_001044754.1| Os01g0839500 [Oryza sativa Japonica Group] gi|75164114|sp|Q943L2.1|H2B11_ORYSJ RecName: Full=Histone H2B.11 gi|152032509|sp|A2WWU2.1|H2B11_ORYSI RecName: Full=Histone H2B.11 gi|15623830|dbj|BAB67889.1| putative histone H2B [Oryza sativa Japonica Group] gi|21104617|dbj|BAB93209.1| putative histone H2B [Oryza sativa Japonica Group] gi|113534285|dbj|BAF06668.1| Os01g0839500 [Oryza sativa Japonica Group] gi|125528324|gb|EAY76438.1| hypothetical protein OsI_04371 [Oryza sativa Indica Group] gi|125572582|gb|EAZ14097.1| hypothetical protein OsJ_04020 [Oryza sativa Japonica Group] Length = 139 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 50 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNK 100 >ref|XP_002533106.1| histone h2b, putative [Ricinus communis] gi|223527097|gb|EEF29278.1| histone h2b, putative [Ricinus communis] Length = 146 Score = 99.0 bits (245), Expect = 6e-19 Identities = 52/76 (68%), Positives = 54/76 (71%) Frame = +3 Query: 51 GKRLPXXXXXXXXXXXXXXXXXXXXETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDI 230 GK+LP ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDI Sbjct: 34 GKKLPKEGGAAAAGDKKKKRTKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDI 93 Query: 231 FEKLAQEAVRLARYNK 278 FEKLAQEA RLARYNK Sbjct: 94 FEKLAQEASRLARYNK 109 >gb|EMT26655.1| Putative histone H2B.1 [Aegilops tauschii] Length = 145 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA +LARYNK Sbjct: 56 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNK 106 >gb|EMS49652.1| putative histone H2B.1 [Triticum urartu] Length = 149 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA +LARYNK Sbjct: 60 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNK 110 >ref|XP_003568303.1| PREDICTED: histone H2B.6-like [Brachypodium distachyon] Length = 147 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEA +LARYNK Sbjct: 58 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNK 108 >ref|XP_002439923.1| hypothetical protein SORBIDRAFT_09g022610 [Sorghum bicolor] gi|241945208|gb|EES18353.1| hypothetical protein SORBIDRAFT_09g022610 [Sorghum bicolor] Length = 147 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGIS+KAMSIMNSFINDIFEKLAQEA RLARYNK Sbjct: 58 ETYKIYIFKVLKQVHPDIGISAKAMSIMNSFINDIFEKLAQEAARLARYNK 108 >gb|EOY33678.1| Histone superfamily protein [Theobroma cacao] Length = 142 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDIFEKLAQEA RLARYNK Sbjct: 53 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNK 103 >ref|XP_003543443.1| PREDICTED: probable histone H2B.1-like [Glycine max] Length = 133 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDIFEKLAQEA RLARYNK Sbjct: 44 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNK 94 >ref|XP_003540207.1| PREDICTED: histone H2B.3 [Glycine max] Length = 134 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDIFEKLAQEA RLARYNK Sbjct: 45 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNK 95 >ref|XP_002523734.1| histone h2b, putative [Ricinus communis] gi|223537038|gb|EEF38674.1| histone h2b, putative [Ricinus communis] Length = 141 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +3 Query: 126 ETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAVRLARYNK 278 ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDIFEKLAQEA RLARYNK Sbjct: 52 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNK 102 >ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 292 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = +3 Query: 51 GKRLPXXXXXXXXXXXXXXXXXXXXETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDI 230 GK+LP ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDI Sbjct: 35 GKKLPKEGGAGGEGGKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDI 94 Query: 231 FEKLAQEAVRLARYNK 278 FEKLAQE+ RLARYNK Sbjct: 95 FEKLAQESSRLARYNK 110 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = +3 Query: 51 GKRLPXXXXXXXXXXXXXXXXXXXXETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDI 230 GK+LP ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDI Sbjct: 178 GKKLPKEGGAGGEGGKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDI 237 Query: 231 FEKLAQEAVRLARYNK 278 FEKLAQE+ RLARYNK Sbjct: 238 FEKLAQESSRLARYNK 253 >ref|XP_006349988.1| PREDICTED: histone H2B-like [Solanum tuberosum] Length = 144 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = +3 Query: 51 GKRLPXXXXXXXXXXXXXXXXXXXXETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDI 230 GK+LP ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDI Sbjct: 30 GKKLPKDGGAAAAGDKKKKRSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDI 89 Query: 231 FEKLAQEAVRLARYNK 278 FEKLAQE+ RLARYNK Sbjct: 90 FEKLAQESSRLARYNK 105 >ref|XP_006349986.1| PREDICTED: probable histone H2B.1-like [Solanum tuberosum] Length = 144 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = +3 Query: 51 GKRLPXXXXXXXXXXXXXXXXXXXXETYKIYIFRVLKQVHPDIGISSKAMSIMNSFINDI 230 GK+LP ETYKIYIF+VLKQVHPDIGISSKAM IMNSFINDI Sbjct: 30 GKKLPKDSGAAAAGAKKKKRSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDI 89 Query: 231 FEKLAQEAVRLARYNK 278 FEKLAQE+ RLARYNK Sbjct: 90 FEKLAQESSRLARYNK 105