BLASTX nr result
ID: Zingiber23_contig00014383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014383 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 81 2e-13 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 69 9e-10 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 80.9 bits (198), Expect = 2e-13 Identities = 42/63 (66%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -1 Query: 377 ISNLDKPGTTVRREKTRSHSDLDMWNRLAPYVLK*FGRHGQ--SPKKEVKKMICKIEFFI 204 I N DKPGTTVRRE TRSHSDLDMWNRLAPYVLK FGRHG+ PK+E + E F Sbjct: 564 IGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHGKISRPKEEGNEWDKTHEIFE 623 Query: 203 SLR 195 +R Sbjct: 624 HIR 626 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 252 ALTMSPELFQYIWRKTIPHIEVGMGSGLFTSHRSARLVEI 371 A TMSPE QYIWRKTIPHIEVGMGSG+FTS+RSAR V I Sbjct: 43 AWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLI 82