BLASTX nr result
ID: Zingiber23_contig00014291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014291 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004957820.1| PREDICTED: uncharacterized protein LOC101775... 58 1e-06 dbj|BAC83950.1| putative ATP-dependent proteinase; BsgA [Oryza s... 58 1e-06 ref|XP_002462915.1| hypothetical protein SORBIDRAFT_02g034360 [S... 58 1e-06 ref|NP_001147200.1| peptidase S16, lon [Zea mays] gi|195608442|g... 58 1e-06 ref|NP_001132195.1| uncharacterized protein LOC100193623 [Zea ma... 58 1e-06 gb|EAZ39959.1| hypothetical protein OsJ_24396 [Oryza sativa Japo... 58 1e-06 gb|EMT31451.1| hypothetical protein F775_18888 [Aegilops tauschii] 57 3e-06 gb|EMS63879.1| hypothetical protein TRIUR3_25279 [Triticum urartu] 57 3e-06 gb|AFW86334.1| hypothetical protein ZEAMMB73_213889 [Zea mays] 57 3e-06 ref|XP_003563043.1| PREDICTED: lon protease 2-like [Brachypodium... 57 3e-06 dbj|BAJ93048.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 >ref|XP_004957820.1| PREDICTED: uncharacterized protein LOC101775747 [Setaria italica] Length = 288 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 255 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 287 >dbj|BAC83950.1| putative ATP-dependent proteinase; BsgA [Oryza sativa Japonica Group] gi|125558477|gb|EAZ04013.1| hypothetical protein OsI_26152 [Oryza sativa Indica Group] gi|215768931|dbj|BAH01160.1| unnamed protein product [Oryza sativa Japonica Group] Length = 291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 258 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 290 >ref|XP_002462915.1| hypothetical protein SORBIDRAFT_02g034360 [Sorghum bicolor] gi|241926292|gb|EER99436.1| hypothetical protein SORBIDRAFT_02g034360 [Sorghum bicolor] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 253 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 285 >ref|NP_001147200.1| peptidase S16, lon [Zea mays] gi|195608442|gb|ACG26051.1| peptidase S16, lon [Zea mays] gi|414886842|tpg|DAA62856.1| TPA: peptidase S16, lon [Zea mays] Length = 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 253 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 285 >ref|NP_001132195.1| uncharacterized protein LOC100193623 [Zea mays] gi|194693726|gb|ACF80947.1| unknown [Zea mays] Length = 289 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 256 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 288 >gb|EAZ39959.1| hypothetical protein OsJ_24396 [Oryza sativa Japonica Group] Length = 291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKDAF S SS Sbjct: 258 ARLRRERDTLRNTLNYLTAASAVKDAFPSSPSS 290 >gb|EMT31451.1| hypothetical protein F775_18888 [Aegilops tauschii] Length = 204 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKD F S SS Sbjct: 171 ARLRRERDTLRNTLNYLTAASAVKDVFPSSPSS 203 >gb|EMS63879.1| hypothetical protein TRIUR3_25279 [Triticum urartu] Length = 148 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKD F S SS Sbjct: 115 ARLRRERDTLRNTLNYLTAASAVKDVFPSSPSS 147 >gb|AFW86334.1| hypothetical protein ZEAMMB73_213889 [Zea mays] Length = 237 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLT ASAVKDAF S SS Sbjct: 204 ARLRRERDTLRNTLNYLTTASAVKDAFPSSPSS 236 >ref|XP_003563043.1| PREDICTED: lon protease 2-like [Brachypodium distachyon] Length = 288 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKD F S SS Sbjct: 255 ARLRRERDTLRNTLNYLTAASAVKDVFPSSPSS 287 >dbj|BAJ93048.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 286 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 344 ARLRRERDTLRNTLNYLTAASAVKDAFSPSNSS 246 ARLRRERDTLRNTLNYLTAASAVKD F S SS Sbjct: 253 ARLRRERDTLRNTLNYLTAASAVKDVFPSSPSS 285