BLASTX nr result
ID: Zingiber23_contig00014254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014254 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479195.1| PREDICTED: transcription factor IIIB 90 kDa ... 63 5e-08 ref|XP_006443522.1| hypothetical protein CICLE_v10019321mg [Citr... 63 5e-08 ref|XP_006443520.1| hypothetical protein CICLE_v10019321mg [Citr... 63 5e-08 ref|XP_006443519.1| hypothetical protein CICLE_v10019321mg [Citr... 63 5e-08 ref|XP_006443518.1| hypothetical protein CICLE_v10019321mg [Citr... 63 5e-08 ref|XP_002314140.2| hypothetical protein POPTR_0009s04400g [Popu... 60 2e-07 ref|XP_002525676.1| transcription initiation factor brf1, putati... 60 3e-07 gb|EOY10450.1| Cyclin/Brf1-like TBP-binding protein, putative is... 60 4e-07 gb|EOY10449.1| Cyclin/Brf1-like TBP-binding protein, putative is... 60 4e-07 gb|EOY10448.1| Cyclin/Brf1-like TBP-binding protein, putative is... 60 4e-07 ref|XP_006354652.1| PREDICTED: transcription factor IIIB 90 kDa ... 59 5e-07 ref|XP_004229719.1| PREDICTED: transcription factor IIIB 90 kDa ... 59 5e-07 ref|XP_006369550.1| hypothetical protein POPTR_0001s25330g [Popu... 59 7e-07 ref|XP_002269372.2| PREDICTED: transcription factor IIIB 90 kDa ... 59 9e-07 emb|CBI31214.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_004157302.1| PREDICTED: transcription factor IIIB 60 kDa ... 57 2e-06 ref|XP_004135795.1| PREDICTED: transcription factor IIIB 60 kDa ... 57 2e-06 ref|XP_002440164.1| hypothetical protein SORBIDRAFT_09g027090 [S... 55 7e-06 ref|XP_006407684.1| hypothetical protein EUTSA_v10020503mg [Eutr... 55 1e-05 >ref|XP_006479195.1| PREDICTED: transcription factor IIIB 90 kDa subunit-like isoform X2 [Citrus sinensis] Length = 618 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +DGSD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 410 SDGSDNFSDIDDFEVDGYLHNEEEKHYKKIIWEEMNREYL 449 >ref|XP_006443522.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|568851023|ref|XP_006479194.1| PREDICTED: transcription factor IIIB 90 kDa subunit-like isoform X1 [Citrus sinensis] gi|557545784|gb|ESR56762.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] Length = 620 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +DGSD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 412 SDGSDNFSDIDDFEVDGYLHNEEEKHYKKIIWEEMNREYL 451 >ref|XP_006443520.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|567902066|ref|XP_006443521.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|557545782|gb|ESR56760.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|557545783|gb|ESR56761.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] Length = 543 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +DGSD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 335 SDGSDNFSDIDDFEVDGYLHNEEEKHYKKIIWEEMNREYL 374 >ref|XP_006443519.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|557545781|gb|ESR56759.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] Length = 567 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +DGSD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 412 SDGSDNFSDIDDFEVDGYLHNEEEKHYKKIIWEEMNREYL 451 >ref|XP_006443518.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] gi|557545780|gb|ESR56758.1| hypothetical protein CICLE_v10019321mg [Citrus clementina] Length = 454 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +DGSD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 412 SDGSDNFSDIDDFEVDGYLHNEEEKHYKKIIWEEMNREYL 451 >ref|XP_002314140.2| hypothetical protein POPTR_0009s04400g [Populus trichocarpa] gi|550331015|gb|EEE88095.2| hypothetical protein POPTR_0009s04400g [Populus trichocarpa] Length = 562 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D SD FSDIDDAEV+ LH E+EK KKIIWE MNREYL Sbjct: 373 DESDGFSDIDDAEVDSYLHNEEEKRYKKIIWEEMNREYL 411 >ref|XP_002525676.1| transcription initiation factor brf1, putative [Ricinus communis] gi|223534976|gb|EEF36659.1| transcription initiation factor brf1, putative [Ricinus communis] Length = 625 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D SD+FSDIDDAEV+ LH E+E KKIIWE MNREYL Sbjct: 415 DESDNFSDIDDAEVDGYLHNEEEAQFKKIIWEEMNREYL 453 >gb|EOY10450.1| Cyclin/Brf1-like TBP-binding protein, putative isoform 3 [Theobroma cacao] Length = 503 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D SD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 401 DESDNFSDIDDLEVDGYLHNEEEKRFKKIIWEEMNREYL 439 >gb|EOY10449.1| Cyclin/Brf1-like TBP-binding protein, putative isoform 2 [Theobroma cacao] Length = 492 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D SD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 401 DESDNFSDIDDLEVDGYLHNEEEKRFKKIIWEEMNREYL 439 >gb|EOY10448.1| Cyclin/Brf1-like TBP-binding protein, putative isoform 1 [Theobroma cacao] Length = 605 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D SD+FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 401 DESDNFSDIDDLEVDGYLHNEEEKRFKKIIWEEMNREYL 439 >ref|XP_006354652.1| PREDICTED: transcription factor IIIB 90 kDa subunit-like [Solanum tuberosum] Length = 615 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 354 ENDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 ++D S +FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 422 DHDESGNFSDIDDVEVDSYLHNEQEKKYKKIIWETMNREYL 462 >ref|XP_004229719.1| PREDICTED: transcription factor IIIB 90 kDa subunit-like [Solanum lycopersicum] Length = 615 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 354 ENDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 ++D S +FSDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 422 DHDESGNFSDIDDVEVDSYLHNEQEKKYKKIIWETMNREYL 462 >ref|XP_006369550.1| hypothetical protein POPTR_0001s25330g [Populus trichocarpa] gi|550348149|gb|ERP66119.1| hypothetical protein POPTR_0001s25330g [Populus trichocarpa] Length = 508 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 342 SDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 SD FSDIDDAEV+ LH E+EK KKIIWE MNREYL Sbjct: 304 SDGFSDIDDAEVDSYLHNEEEKRYKKIIWEEMNREYL 340 >ref|XP_002269372.2| PREDICTED: transcription factor IIIB 90 kDa subunit-like [Vitis vinifera] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D S+ SDIDD EV+ LH EKEK KKIIWEAMN+EYL Sbjct: 416 DESESLSDIDDVEVDGYLHNEKEKQFKKIIWEAMNKEYL 454 >emb|CBI31214.3| unnamed protein product [Vitis vinifera] Length = 622 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 348 DGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 D S+ SDIDD EV+ LH EKEK KKIIWEAMN+EYL Sbjct: 416 DESESLSDIDDVEVDGYLHNEKEKQFKKIIWEAMNKEYL 454 >ref|XP_004157302.1| PREDICTED: transcription factor IIIB 60 kDa subunit-like [Cucumis sativus] Length = 663 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +D S+++SDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 458 SDDSENWSDIDDVEVDGYLHNEEEKHYKKIIWEEMNREYL 497 >ref|XP_004135795.1| PREDICTED: transcription factor IIIB 60 kDa subunit-like [Cucumis sativus] Length = 643 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 +D S+++SDIDD EV+ LH E+EK KKIIWE MNREYL Sbjct: 458 SDDSENWSDIDDVEVDGYLHNEEEKHYKKIIWEEMNREYL 497 >ref|XP_002440164.1| hypothetical protein SORBIDRAFT_09g027090 [Sorghum bicolor] gi|241945449|gb|EES18594.1| hypothetical protein SORBIDRAFT_09g027090 [Sorghum bicolor] Length = 579 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 351 NDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 N S+ SDIDDAEV+ LH E+EK KKIIWE MN+EYL Sbjct: 415 NADSESLSDIDDAEVDWYLHNEEEKQYKKIIWEEMNKEYL 454 >ref|XP_006407684.1| hypothetical protein EUTSA_v10020503mg [Eutrema salsugineum] gi|567201379|ref|XP_006407685.1| hypothetical protein EUTSA_v10020503mg [Eutrema salsugineum] gi|557108830|gb|ESQ49137.1| hypothetical protein EUTSA_v10020503mg [Eutrema salsugineum] gi|557108831|gb|ESQ49138.1| hypothetical protein EUTSA_v10020503mg [Eutrema salsugineum] Length = 525 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -3 Query: 354 ENDGSDHFSDIDDAEVNRCLHTEKEKDLKKIIWEAMNREYL 232 ++D SD+FSD++D EV+ +H E+EK KKI+WE MN+EYL Sbjct: 402 DSDESDNFSDVNDDEVDGYIHNEEEKRYKKILWEEMNKEYL 442