BLASTX nr result
ID: Zingiber23_contig00014124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014124 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002452397.1| hypothetical protein SORBIDRAFT_04g025040 [S... 56 4e-06 >ref|XP_002452397.1| hypothetical protein SORBIDRAFT_04g025040 [Sorghum bicolor] gi|241932228|gb|EES05373.1| hypothetical protein SORBIDRAFT_04g025040 [Sorghum bicolor] Length = 1756 Score = 56.2 bits (134), Expect = 4e-06 Identities = 35/78 (44%), Positives = 49/78 (62%) Frame = -1 Query: 271 VLVDLPGQTDQDSRSMRGDPDTGILVNIDGSMQESVDESGREETFEDASDILSRTESSRS 92 VLV+LP Q ++RS DPD G+LVN+ D++ ETFEDA D L+ + S + Sbjct: 44 VLVELPAQ---EARSPGADPDGGVLVNMPA------DDATSGETFEDAPDDLAASGSRSA 94 Query: 91 LALEESMAVIEFGERSDS 38 +L+ESMAVI+F E S + Sbjct: 95 RSLDESMAVIDFPEVSST 112