BLASTX nr result
ID: Zingiber23_contig00013140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00013140 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16290.3| unnamed protein product [Vitis vinifera] 66 5e-09 ref|XP_001752331.1| predicted protein [Physcomitrella patens] gi... 66 5e-09 ref|XP_001781006.1| predicted protein [Physcomitrella patens] gi... 66 5e-09 ref|XP_001783123.1| predicted protein [Physcomitrella patens] gi... 66 5e-09 gb|ABK25751.1| unknown [Picea sitchensis] gi|116791539|gb|ABK260... 66 5e-09 ref|XP_002285035.1| PREDICTED: protein transport protein Sec61 s... 66 5e-09 ref|XP_002276029.1| PREDICTED: protein transport protein Sec61 s... 66 5e-09 gb|ABG24204.1| putative transport protein [Gymnadenia conopsea] 66 5e-09 ref|XP_004309422.1| PREDICTED: protein transport protein Sec61 s... 65 1e-08 gb|EMJ07369.1| hypothetical protein PRUPE_ppa013697mg [Prunus pe... 65 1e-08 gb|ESW04188.1| hypothetical protein PHAVU_011G073900g [Phaseolus... 64 2e-08 gb|EOY33053.1| Transport protein SEC61 subunit beta, partial [Th... 64 2e-08 ref|XP_004505968.1| PREDICTED: protein transport protein Sec61 s... 64 2e-08 ref|XP_003597194.1| Protein transport protein Sec61 beta subunit... 64 2e-08 ref|XP_003543483.1| PREDICTED: protein transport protein Sec61 s... 64 2e-08 ref|XP_003540170.1| PREDICTED: protein transport protein Sec61 s... 64 2e-08 ref|XP_003538051.1| PREDICTED: protein transport protein Sec61 s... 64 2e-08 ref|NP_200854.1| protein transport protein SEC61 subunit beta [... 64 2e-08 ref|XP_006281590.1| hypothetical protein CARUB_v10027703mg [Caps... 64 2e-08 ref|XP_002314275.1| predicted protein [Populus trichocarpa] 64 3e-08 >emb|CBI16290.3| unnamed protein product [Vitis vinifera] Length = 699 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 650 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 682 >ref|XP_001752331.1| predicted protein [Physcomitrella patens] gi|162696726|gb|EDQ83064.1| predicted protein [Physcomitrella patens] Length = 76 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 35 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 67 >ref|XP_001781006.1| predicted protein [Physcomitrella patens] gi|162667563|gb|EDQ54190.1| predicted protein [Physcomitrella patens] Length = 81 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 35 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 67 >ref|XP_001783123.1| predicted protein [Physcomitrella patens] gi|162665373|gb|EDQ52060.1| predicted protein [Physcomitrella patens] Length = 82 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 37 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 69 >gb|ABK25751.1| unknown [Picea sitchensis] gi|116791539|gb|ABK26018.1| unknown [Picea sitchensis] gi|224286463|gb|ACN40938.1| unknown [Picea sitchensis] Length = 108 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 60 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 92 >ref|XP_002285035.1| PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] Length = 107 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 58 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 90 >ref|XP_002276029.1| PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] gi|147800942|emb|CAN75561.1| hypothetical protein VITISV_032577 [Vitis vinifera] Length = 108 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 59 SNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 91 >gb|ABG24204.1| putative transport protein [Gymnadenia conopsea] Length = 107 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLKM+PTVVL +SLCFIGFVT Sbjct: 59 SNMLRFYTDDAPGLKMSPTVVLVMSLCFIGFVT 91 >ref|XP_004309422.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Fragaria vesca subsp. vesca] Length = 109 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 +NMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 60 NNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 92 >gb|EMJ07369.1| hypothetical protein PRUPE_ppa013697mg [Prunus persica] Length = 108 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 +NMLRFYTDDAPGLK+TPTVVL +SLCFIGFVT Sbjct: 59 NNMLRFYTDDAPGLKITPTVVLVMSLCFIGFVT 91 >gb|ESW04188.1| hypothetical protein PHAVU_011G073900g [Phaseolus vulgaris] gi|561028457|gb|ESW27097.1| hypothetical protein PHAVU_003G173500g [Phaseolus vulgaris] Length = 106 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 57 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 89 >gb|EOY33053.1| Transport protein SEC61 subunit beta, partial [Theobroma cacao] Length = 162 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 113 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 145 >ref|XP_004505968.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Cicer arietinum] Length = 107 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 58 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 90 >ref|XP_003597194.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] gi|87241202|gb|ABD33060.1| Sec61beta [Medicago truncatula] gi|355486242|gb|AES67445.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] Length = 107 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 58 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 90 >ref|XP_003543483.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] Length = 105 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 56 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 88 >ref|XP_003540170.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] Length = 105 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 56 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 88 >ref|XP_003538051.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform X1 [Glycine max] gi|571488766|ref|XP_006591027.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform X2 [Glycine max] Length = 107 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 57 SNMLRFYTDDAPGLKISPTVVLVMSLCFIGFVT 89 >ref|NP_200854.1| protein transport protein SEC61 subunit beta [Arabidopsis thaliana] gi|9757748|dbj|BAB08229.1| unnamed protein product [Arabidopsis thaliana] gi|26451290|dbj|BAC42746.1| protein transport protein subunit - like [Arabidopsis thaliana] gi|28973101|gb|AAO63875.1| putative protein transport protein subunit [Arabidopsis thaliana] gi|332009950|gb|AED97333.1| protein transport protein SEC61 subunit beta [Arabidopsis thaliana] Length = 109 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 60 SNMLRFYTDDAPGLKISPTVVLIMSLCFIGFVT 92 >ref|XP_006281590.1| hypothetical protein CARUB_v10027703mg [Capsella rubella] gi|482550294|gb|EOA14488.1| hypothetical protein CARUB_v10027703mg [Capsella rubella] Length = 109 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 109 SNMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 SNMLRFYTDDAPGLK++PTVVL +SLCFIGFVT Sbjct: 59 SNMLRFYTDDAPGLKISPTVVLIMSLCFIGFVT 91 >ref|XP_002314275.1| predicted protein [Populus trichocarpa] Length = 83 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 112 NMLRFYTDDAPGLKMTPTVVLAISLCFIGFVT 207 NMLRFYTDDAPGLK++PT+VL ISLCFIGFVT Sbjct: 41 NMLRFYTDDAPGLKISPTIVLVISLCFIGFVT 72