BLASTX nr result
ID: Zingiber23_contig00012935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00012935 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847757.1| hypothetical protein AMTR_s00162p00029070 [A... 59 9e-07 >ref|XP_006847757.1| hypothetical protein AMTR_s00162p00029070 [Amborella trichopoda] gi|548851058|gb|ERN09338.1| hypothetical protein AMTR_s00162p00029070 [Amborella trichopoda] Length = 433 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = +2 Query: 77 MATNQIFVKFLDGRTRCLQIPSPTVSGEALRRDIVTRTGIPLRYLRVVSG 226 MAT+QI V+ LDG+TRC+QI +P ++G +L+ I RTGIP+ + R+V+G Sbjct: 1 MATHQILVRLLDGQTRCIQIENPRITGSSLKNLIRERTGIPVPFQRLVAG 50