BLASTX nr result
ID: Zingiber23_contig00010737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00010737 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB91565.1| hypothetical protein L484_016185 [Morus notabilis] 94 2e-17 ref|XP_006359513.1| PREDICTED: uncharacterized protein LOC102584... 92 9e-17 gb|EXB67229.1| hypothetical protein L484_025707 [Morus notabilis] 91 1e-16 gb|EOY25950.1| Major facilitator superfamily protein [Theobroma ... 91 2e-16 ref|XP_006852818.1| hypothetical protein AMTR_s00033p00175020 [A... 90 3e-16 ref|XP_004242721.1| PREDICTED: uncharacterized protein LOC101255... 90 3e-16 ref|XP_006474315.1| PREDICTED: uncharacterized membrane protein ... 90 4e-16 ref|XP_006453197.1| hypothetical protein CICLE_v100078531mg, par... 90 4e-16 ref|XP_002530466.1| conserved hypothetical protein [Ricinus comm... 89 5e-16 ref|XP_004303264.1| PREDICTED: uncharacterized membrane protein ... 89 6e-16 gb|EMT26269.1| hypothetical protein F775_26749 [Aegilops tauschii] 88 1e-15 gb|EMS46208.1| hypothetical protein TRIUR3_22471 [Triticum urartu] 88 1e-15 ref|XP_002268798.2| PREDICTED: uncharacterized protein LOC100251... 88 1e-15 dbj|BAK00222.1| predicted protein [Hordeum vulgare subsp. vulgare] 88 1e-15 emb|CBI25573.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_002331009.1| predicted protein [Populus trichocarpa] gi|5... 88 1e-15 ref|XP_006427482.1| hypothetical protein CICLE_v10025286mg [Citr... 87 2e-15 ref|XP_006427480.1| hypothetical protein CICLE_v10025286mg [Citr... 87 2e-15 ref|XP_002298207.2| hypothetical protein POPTR_0001s21170g [Popu... 87 3e-15 ref|XP_006465227.1| PREDICTED: uncharacterized membrane protein ... 86 4e-15 >gb|EXB91565.1| hypothetical protein L484_016185 [Morus notabilis] Length = 573 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SSSTCLGPNCFRLTF+ LA +C +GTLLSI+L++R +PVYQMLYA GSFRLP+S+ H Sbjct: 517 SSSTCLGPNCFRLTFFVLAAVCGVGTLLSIVLTIRIKPVYQMLYAGGSFRLPQSTNH 573 >ref|XP_006359513.1| PREDICTED: uncharacterized protein LOC102584997 [Solanum tuberosum] Length = 559 Score = 91.7 bits (226), Expect = 9e-17 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 S+TCLGP+CFR+TF LAG+C LGT+LSI+L++R RPVYQMLYA GSFRLP+SS H Sbjct: 504 SATCLGPDCFRVTFLILAGVCGLGTVLSIVLTMRIRPVYQMLYAGGSFRLPQSSSH 559 >gb|EXB67229.1| hypothetical protein L484_025707 [Morus notabilis] Length = 153 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = +1 Query: 7 STCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 STCLGP+CFRLTF LAG+C LGT++ IIL++R RPVYQMLYA GSFRLP+SS H Sbjct: 99 STCLGPDCFRLTFQVLAGVCGLGTIMGIILTIRIRPVYQMLYAGGSFRLPQSSSH 153 >gb|EOY25950.1| Major facilitator superfamily protein [Theobroma cacao] Length = 564 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SSTCLGP CFRLTF+ LAGIC LGT LSI L++R RPVY+MLY+SGSFRLP++S H Sbjct: 509 SSTCLGPECFRLTFFVLAGICGLGTFLSIFLTIRLRPVYKMLYSSGSFRLPQASDH 564 >ref|XP_006852818.1| hypothetical protein AMTR_s00033p00175020 [Amborella trichopoda] gi|548856432|gb|ERN14285.1| hypothetical protein AMTR_s00033p00175020 [Amborella trichopoda] Length = 585 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/55 (70%), Positives = 50/55 (90%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSS 165 SSS+CLGPNCFRLTF+ L+G+C LG+ LS+IL++R RPVYQMLY+ GSFR+PR+S Sbjct: 529 SSSSCLGPNCFRLTFFVLSGVCFLGSFLSVILTLRLRPVYQMLYSGGSFRIPRNS 583 >ref|XP_004242721.1| PREDICTED: uncharacterized protein LOC101255210 [Solanum lycopersicum] Length = 559 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 S+TC GP+CFR+TF LAG+C LGT+LSI+L++R RPVYQMLYA GSFRLP+SS H Sbjct: 504 SATCFGPDCFRVTFLILAGVCGLGTVLSIVLTMRIRPVYQMLYAGGSFRLPQSSSH 559 >ref|XP_006474315.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus sinensis] Length = 574 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +1 Query: 10 TCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSS 165 +CLGPNCFR+TF+ LAG+CC+G++ SIIL++R RPVYQMLYA GSFRLP++S Sbjct: 521 SCLGPNCFRITFFVLAGVCCVGSIFSIILNIRIRPVYQMLYAGGSFRLPQTS 572 >ref|XP_006453197.1| hypothetical protein CICLE_v100078531mg, partial [Citrus clementina] gi|557556423|gb|ESR66437.1| hypothetical protein CICLE_v100078531mg, partial [Citrus clementina] Length = 466 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +1 Query: 10 TCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSS 165 +CLGPNCFR+TF+ LAG+CC+G++ SIIL++R RPVYQMLYA GSFRLP++S Sbjct: 413 SCLGPNCFRITFFVLAGVCCVGSIFSIILNIRIRPVYQMLYAGGSFRLPQTS 464 >ref|XP_002530466.1| conserved hypothetical protein [Ricinus communis] gi|223530011|gb|EEF31936.1| conserved hypothetical protein [Ricinus communis] Length = 510 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SS+C+G CFRLTF LAGIC LGT+LSIIL+VR RPVYQMLYA GSFRLP+SS H Sbjct: 455 SSSCIGAGCFRLTFLVLAGICGLGTILSIILTVRIRPVYQMLYAGGSFRLPQSSGH 510 >ref|XP_004303264.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Fragaria vesca subsp. vesca] Length = 560 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 +STC+G +CFR+TF LAG+C LGT+LSIIL+VR RPVYQMLYA GSFRLP S++H Sbjct: 505 TSTCVGADCFRITFLVLAGVCGLGTVLSIILTVRVRPVYQMLYAGGSFRLPSSAIH 560 >gb|EMT26269.1| hypothetical protein F775_26749 [Aegilops tauschii] Length = 544 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +1 Query: 13 CLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 C GPNCFRLTF+ L+G+ CLGTLLSI+L+VR RPVYQMLYA GSF PRSS H Sbjct: 492 CHGPNCFRLTFFILSGMACLGTLLSIVLTVRIRPVYQMLYAGGSFSQPRSSAH 544 >gb|EMS46208.1| hypothetical protein TRIUR3_22471 [Triticum urartu] Length = 429 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +1 Query: 13 CLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 C GPNCFRLTF+ L+G+ CLGTLLSI+L+VR RPVYQMLYA GSF PRSS H Sbjct: 377 CHGPNCFRLTFFILSGMACLGTLLSIVLTVRIRPVYQMLYAGGSFSQPRSSAH 429 >ref|XP_002268798.2| PREDICTED: uncharacterized protein LOC100251745 [Vitis vinifera] Length = 573 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/57 (70%), Positives = 50/57 (87%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SS +CLGPNCFRLTF LAG+C +G++LSIIL++R RPVYQMLY+ GSFRLP++S H Sbjct: 517 SSVSCLGPNCFRLTFLVLAGVCGVGSILSIILTMRIRPVYQMLYSGGSFRLPQNSDH 573 >dbj|BAK00222.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 563 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +1 Query: 13 CLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 C GPNCFRLTF+ L+G+ CLGTLLSI+L+VR RPVYQMLYA GSF PRSS H Sbjct: 511 CHGPNCFRLTFFILSGMACLGTLLSIVLTVRIRPVYQMLYAGGSFSQPRSSAH 563 >emb|CBI25573.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/57 (70%), Positives = 50/57 (87%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SS +CLGPNCFRLTF LAG+C +G++LSIIL++R RPVYQMLY+ GSFRLP++S H Sbjct: 456 SSVSCLGPNCFRLTFLVLAGVCGVGSILSIILTMRIRPVYQMLYSGGSFRLPQNSDH 512 >ref|XP_002331009.1| predicted protein [Populus trichocarpa] gi|566174729|ref|XP_006381072.1| hypothetical protein POPTR_0006s05990g [Populus trichocarpa] gi|550335577|gb|ERP58869.1| hypothetical protein POPTR_0006s05990g [Populus trichocarpa] Length = 580 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SS +CLGPNCFRLTF LAG C LG++LSIIL++R RPVY+MLYA GSFRLP++S H Sbjct: 517 SSISCLGPNCFRLTFLVLAGACGLGSILSIILTMRIRPVYEMLYAGGSFRLPQTSNH 573 >ref|XP_006427482.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] gi|557529472|gb|ESR40722.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] Length = 564 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SSTC+G CFRLTF LAG+C LGT+LSIIL++R RPVYQMLYA GSFR+P+ S H Sbjct: 509 SSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQPSDH 564 >ref|XP_006427480.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] gi|567869719|ref|XP_006427481.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] gi|557529470|gb|ESR40720.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] gi|557529471|gb|ESR40721.1| hypothetical protein CICLE_v10025286mg [Citrus clementina] Length = 431 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SSTC+G CFRLTF LAG+C LGT+LSIIL++R RPVYQMLYA GSFR+P+ S H Sbjct: 376 SSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQPSDH 431 >ref|XP_002298207.2| hypothetical protein POPTR_0001s21170g [Populus trichocarpa] gi|550347797|gb|EEE83012.2| hypothetical protein POPTR_0001s21170g [Populus trichocarpa] Length = 431 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/57 (66%), Positives = 51/57 (89%) Frame = +1 Query: 1 SSSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSSLH 171 SSS+C+GP+CF++TF LAG+C LGT+LSIIL+VR RPVY++LY+ GSFRLP++S H Sbjct: 375 SSSSCVGPDCFKVTFLVLAGVCGLGTILSIILTVRIRPVYELLYSGGSFRLPQTSGH 431 >ref|XP_006465227.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus sinensis] Length = 564 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = +1 Query: 4 SSTCLGPNCFRLTFWFLAGICCLGTLLSIILSVRTRPVYQMLYASGSFRLPRSS 165 SSTC+G CFRLTF LAG+C LGT+LSIIL++R RPVYQMLYA GSFR+P++S Sbjct: 509 SSTCIGAECFRLTFLVLAGVCGLGTILSIILTIRIRPVYQMLYAGGSFRVPQAS 562