BLASTX nr result
ID: Zingiber23_contig00009896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00009896 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003566987.1| PREDICTED: uncharacterized protein LOC100829... 55 7e-06 tpg|DAA58166.1| TPA: hypothetical protein ZEAMMB73_304175 [Zea m... 55 1e-05 >ref|XP_003566987.1| PREDICTED: uncharacterized protein LOC100829484 [Brachypodium distachyon] Length = 85 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -3 Query: 308 MAVSEFVARFDEAARKRLNRMNETLKKLETQMEAMEAEISKAS 180 + VS+FVA+ DEAAR+RL+RMN L+ LE QME +EAE+ +AS Sbjct: 39 VTVSQFVAQLDEAARERLDRMNRRLRLLEQQMETLEAEVGRAS 81 >tpg|DAA58166.1| TPA: hypothetical protein ZEAMMB73_304175 [Zea mays] Length = 99 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = -3 Query: 317 GHVMAVSEFVARFDEAARKRLNRMNETLKKLETQMEAMEAEISKAS 180 G + VS+FVA+ DEAAR+RL+ M++ L+ LE QME +EAE+ KAS Sbjct: 46 GQEVTVSQFVAQLDEAARRRLDSMHQRLRLLEQQMETLEAEVGKAS 91