BLASTX nr result
ID: Zingiber23_contig00006587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00006587 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381897.1| hypothetical protein POPTR_0006s20280g [Popu... 64 3e-08 ref|XP_006372129.1| hypothetical protein POPTR_0018s12030g [Popu... 63 4e-08 ref|XP_006372128.1| hypothetical protein POPTR_0018s12030g [Popu... 63 4e-08 emb|CBI25619.3| unnamed protein product [Vitis vinifera] 62 8e-08 emb|CBI25617.3| unnamed protein product [Vitis vinifera] 62 8e-08 emb|CBI21094.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_006382095.1| hypothetical protein POPTR_0006s27690g [Popu... 61 1e-07 ref|XP_004135586.1| PREDICTED: 60S ribosomal protein L39-like is... 61 1e-07 ref|XP_002523523.1| ribosomal protein L39e, putative [Ricinus co... 61 1e-07 gb|ABR17261.1| unknown [Picea sitchensis] 61 1e-07 ref|XP_002309322.1| hypothetical protein POPTR_0006s27670g [Popu... 61 1e-07 ref|XP_006848747.1| hypothetical protein AMTR_s00026p00023530 [A... 61 2e-07 ref|XP_004145515.1| PREDICTED: 60S ribosomal protein L39-like is... 60 2e-07 ref|XP_003572901.1| PREDICTED: 60S ribosomal protein L39-like [B... 60 2e-07 ref|XP_003564203.1| PREDICTED: 60S ribosomal protein L39-like [B... 60 2e-07 ref|XP_002977927.1| hypothetical protein SELMODRAFT_152207 [Sela... 60 3e-07 ref|XP_002977713.1| hypothetical protein SELMODRAFT_228490 [Sela... 60 3e-07 ref|XP_006450329.1| hypothetical protein CICLE_v10010138mg [Citr... 60 3e-07 gb|EXB38641.1| 60S ribosomal protein L39 [Morus notabilis] 59 5e-07 ref|XP_006295354.1| hypothetical protein CARUB_v10024445mg, part... 59 5e-07 >ref|XP_006381897.1| hypothetical protein POPTR_0006s20280g [Populus trichocarpa] gi|550336708|gb|ERP59694.1| hypothetical protein POPTR_0006s20280g [Populus trichocarpa] Length = 75 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 48 DSGKMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 D+G PSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 21 DNGPYPSHKTFRIKKKLAKKMRQNRPIPHWIR 52 >ref|XP_006372129.1| hypothetical protein POPTR_0018s12030g [Populus trichocarpa] gi|550318562|gb|ERP49926.1| hypothetical protein POPTR_0018s12030g [Populus trichocarpa] Length = 104 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 57 KMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 KMPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 53 KMPSHKTFRIKKKLAKKMRQNRPIPHWIR 81 >ref|XP_006372128.1| hypothetical protein POPTR_0018s12030g [Populus trichocarpa] gi|550318561|gb|ERP49925.1| hypothetical protein POPTR_0018s12030g [Populus trichocarpa] Length = 90 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 57 KMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 KMPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 53 KMPSHKTFRIKKKLAKKMRQNRPIPHWIR 81 >emb|CBI25619.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 57 KMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 KMPSHKTF IK+KLAKKMRQNRPIPHWIR Sbjct: 21 KMPSHKTFMIKKKLAKKMRQNRPIPHWIR 49 >emb|CBI25617.3| unnamed protein product [Vitis vinifera] Length = 70 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 57 KMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 KMPSHKTF IK+KLAKKMRQNRPIPHWIR Sbjct: 19 KMPSHKTFMIKKKLAKKMRQNRPIPHWIR 47 >emb|CBI21094.3| unnamed protein product [Vitis vinifera] Length = 112 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 51 SGKMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 + KMPSHKTF IK+KLAKKMRQNRPIPHWIR Sbjct: 59 TAKMPSHKTFIIKKKLAKKMRQNRPIPHWIR 89 >ref|XP_006382095.1| hypothetical protein POPTR_0006s27690g [Populus trichocarpa] gi|550337213|gb|ERP59892.1| hypothetical protein POPTR_0006s27690g [Populus trichocarpa] Length = 76 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPHWIR 28 >ref|XP_004135586.1| PREDICTED: 60S ribosomal protein L39-like isoform 1 [Cucumis sativus] gi|449435609|ref|XP_004135587.1| PREDICTED: 60S ribosomal protein L39-like isoform 2 [Cucumis sativus] gi|449441878|ref|XP_004138709.1| PREDICTED: 60S ribosomal protein L39-like isoform 1 [Cucumis sativus] gi|449455551|ref|XP_004145516.1| PREDICTED: 60S ribosomal protein L39-like isoform 2 [Cucumis sativus] gi|449485650|ref|XP_004157235.1| PREDICTED: 60S ribosomal protein L39-like isoform 1 [Cucumis sativus] gi|449485654|ref|XP_004157236.1| PREDICTED: 60S ribosomal protein L39-like isoform 2 [Cucumis sativus] gi|449499269|ref|XP_004160771.1| PREDICTED: 60S ribosomal protein L39-like [Cucumis sativus] gi|449521293|ref|XP_004167664.1| PREDICTED: 60S ribosomal protein L39-like isoform 2 [Cucumis sativus] Length = 51 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPHWIR 28 >ref|XP_002523523.1| ribosomal protein L39e, putative [Ricinus communis] gi|223537230|gb|EEF38862.1| ribosomal protein L39e, putative [Ricinus communis] Length = 67 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 57 KMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 KMPSHKTF IK+KLAKKMRQNRPIPHWIR Sbjct: 16 KMPSHKTFIIKKKLAKKMRQNRPIPHWIR 44 >gb|ABR17261.1| unknown [Picea sitchensis] Length = 51 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPHWIR 28 >ref|XP_002309322.1| hypothetical protein POPTR_0006s27670g [Populus trichocarpa] gi|224092556|ref|XP_002309660.1| predicted protein [Populus trichocarpa] gi|224092560|ref|XP_002309662.1| predicted protein [Populus trichocarpa] gi|224142435|ref|XP_002324563.1| 60S ribosomal protein L39 [Populus trichocarpa] gi|224143262|ref|XP_002324897.1| predicted protein [Populus trichocarpa] gi|224150169|ref|XP_002336917.1| predicted protein [Populus trichocarpa] gi|118484124|gb|ABK93945.1| unknown [Populus trichocarpa] gi|118484214|gb|ABK93987.1| unknown [Populus trichocarpa] gi|118484655|gb|ABK94198.1| unknown [Populus trichocarpa] gi|118485050|gb|ABK94389.1| unknown [Populus trichocarpa] gi|118485082|gb|ABK94404.1| unknown [Populus trichocarpa] gi|118485092|gb|ABK94409.1| unknown [Populus trichocarpa] gi|118486670|gb|ABK95172.1| unknown [Populus trichocarpa] gi|222855298|gb|EEE92845.1| hypothetical protein POPTR_0006s27670g [Populus trichocarpa] gi|222865997|gb|EEF03128.1| 60S ribosomal protein L39 [Populus trichocarpa] Length = 51 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFRIKKKLAKKMRQNRPIPHWIR 28 >ref|XP_006848747.1| hypothetical protein AMTR_s00026p00023530 [Amborella trichopoda] gi|548852180|gb|ERN10328.1| hypothetical protein AMTR_s00026p00023530 [Amborella trichopoda] Length = 51 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IK KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFRIKMKLAKKMRQNRPIPHWIR 28 >ref|XP_004145515.1| PREDICTED: 60S ribosomal protein L39-like isoform 1 [Cucumis sativus] gi|449521291|ref|XP_004167663.1| PREDICTED: 60S ribosomal protein L39-like isoform 1 [Cucumis sativus] Length = 70 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 51 SGKMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 S PSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 17 SNTQPSHKTFRIKKKLAKKMRQNRPIPHWIR 47 >ref|XP_003572901.1| PREDICTED: 60S ribosomal protein L39-like [Brachypodium distachyon] Length = 97 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IKQKLAKKMRQNRPIP+WIR Sbjct: 47 MPSHKTFRIKQKLAKKMRQNRPIPYWIR 74 >ref|XP_003564203.1| PREDICTED: 60S ribosomal protein L39-like [Brachypodium distachyon] gi|357145454|ref|XP_003573648.1| PREDICTED: 60S ribosomal protein L39-like [Brachypodium distachyon] Length = 51 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IKQKLAKKMRQNRPIP+WIR Sbjct: 1 MPSHKTFRIKQKLAKKMRQNRPIPYWIR 28 >ref|XP_002977927.1| hypothetical protein SELMODRAFT_152207 [Selaginella moellendorffii] gi|300154630|gb|EFJ21265.1| hypothetical protein SELMODRAFT_152207 [Selaginella moellendorffii] Length = 51 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IKQKL KK+RQNRPIPHWIR Sbjct: 1 MPSHKTFRIKQKLGKKLRQNRPIPHWIR 28 >ref|XP_002977713.1| hypothetical protein SELMODRAFT_228490 [Selaginella moellendorffii] gi|302795592|ref|XP_002979559.1| hypothetical protein SELMODRAFT_228633 [Selaginella moellendorffii] gi|300152807|gb|EFJ19448.1| hypothetical protein SELMODRAFT_228633 [Selaginella moellendorffii] gi|300154416|gb|EFJ21051.1| hypothetical protein SELMODRAFT_228490 [Selaginella moellendorffii] Length = 51 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF+IKQKL KK+RQNRPIPHWIR Sbjct: 1 MPSHKTFRIKQKLGKKLRQNRPIPHWIR 28 >ref|XP_006450329.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] gi|568840009|ref|XP_006473965.1| PREDICTED: 60S ribosomal protein L39-3-like [Citrus sinensis] gi|568859839|ref|XP_006483440.1| PREDICTED: 60S ribosomal protein L39-3-like [Citrus sinensis] gi|209967447|gb|ACJ02352.1| 60S ribosomal protein L39 [Vernicia fordii] gi|257219568|gb|ACV50437.1| 60S ribosomal protein L39 [Jatropha curcas] gi|557553555|gb|ESR63569.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] Length = 51 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 60 MPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 MPSHKTF IK+KLAKKMRQNRPIPHWIR Sbjct: 1 MPSHKTFMIKKKLAKKMRQNRPIPHWIR 28 >gb|EXB38641.1| 60S ribosomal protein L39 [Morus notabilis] Length = 54 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 63 PSHKTFKIKQKLAKKMRQNRPIPHWIR 143 PSHKTF+IK+KLAKKMRQNRPIPHWIR Sbjct: 5 PSHKTFRIKKKLAKKMRQNRPIPHWIR 31 >ref|XP_006295354.1| hypothetical protein CARUB_v10024445mg, partial [Capsella rubella] gi|482564062|gb|EOA28252.1| hypothetical protein CARUB_v10024445mg, partial [Capsella rubella] Length = 77 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 51 SGKMPSHKTFKIKQKLAKKMRQNRPIPHWIR 143 S KMPSHK+F IK+KL KKMRQNRPIPHWIR Sbjct: 24 SFKMPSHKSFMIKKKLGKKMRQNRPIPHWIR 54