BLASTX nr result
ID: Zingiber23_contig00003891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003891 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV46368.1| manganese superoxide dismutase MSD1E-1 [Musa acum... 89 6e-16 gb|AFV46366.1| manganese superoxide dismutase MSD1E-1 [Musa acum... 89 6e-16 gb|AFX61786.1| manganese superoxide dismutase [Musa acuminata] 89 8e-16 gb|AFX61785.1| manganese superoxide dismutase [Musa acuminata AA... 89 8e-16 gb|AEF57554.1| Mn-superoxide dismutase [Musa acuminata] 89 8e-16 gb|AED99253.1| Mn-superoxide dismutase [Musa acuminata] 89 8e-16 gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] 88 1e-15 gb|ABA00455.1| MnSOD [Gossypium hirsutum] 88 1e-15 emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] 88 1e-15 ref|XP_004502849.1| PREDICTED: superoxide dismutase [Mn], mitoch... 88 1e-15 gb|ACU16940.1| unknown [Glycine max] 88 1e-15 ref|NP_001235066.1| MnSOD [Glycine max] gi|356516259|ref|XP_0035... 88 1e-15 sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], ... 87 2e-15 gb|AGI65627.1| Mn-superoxide dismutase, partial [Fragaria x anan... 87 2e-15 ref|XP_004307727.1| PREDICTED: superoxide dismutase [Mn], mitoch... 87 2e-15 gb|AAC15806.1| superoxide dismutase [Raphanus sativus] 87 2e-15 gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus ... 87 2e-15 gb|AEZ56249.1| manganese superoxide dismutase [Prunus persica] g... 87 2e-15 ref|XP_006407489.1| hypothetical protein EUTSA_v10021449mg [Eutr... 87 2e-15 gb|ABL75952.1| putative Mn superoxide dismutase [Eutrema halophi... 87 2e-15 >gb|AFV46368.1| manganese superoxide dismutase MSD1E-1 [Musa acuminata] Length = 238 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEV+D+ETA Sbjct: 198 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVFDEETA 238 >gb|AFV46366.1| manganese superoxide dismutase MSD1E-1 [Musa acuminata AAA Group] Length = 238 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEV+D+ETA Sbjct: 198 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVFDEETA 238 >gb|AFX61786.1| manganese superoxide dismutase [Musa acuminata] Length = 245 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVI+WKYASEVY+KETA Sbjct: 205 IDVWEHAYYLQYKNVRPDYLKNIWKVIDWKYASEVYEKETA 245 >gb|AFX61785.1| manganese superoxide dismutase [Musa acuminata AAA Group] Length = 245 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVI+WKYASEVY+KETA Sbjct: 205 IDVWEHAYYLQYKNVRPDYLKNIWKVIDWKYASEVYEKETA 245 >gb|AEF57554.1| Mn-superoxide dismutase [Musa acuminata] Length = 180 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVI+WKYASEVY+KETA Sbjct: 140 IDVWEHAYYLQYKNVRPDYLKNIWKVIDWKYASEVYEKETA 180 >gb|AED99253.1| Mn-superoxide dismutase [Musa acuminata] Length = 195 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVI+WKYASEVY+KETA Sbjct: 155 IDVWEHAYYLQYKNVRPDYLKNIWKVIDWKYASEVYEKETA 195 >gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] Length = 198 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE A Sbjct: 158 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKECA 198 >gb|ABA00455.1| MnSOD [Gossypium hirsutum] Length = 231 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE A Sbjct: 191 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKECA 231 >emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] Length = 224 Score = 88.2 bits (217), Expect = 1e-15 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKE 119 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASE+YDKE Sbjct: 184 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEIYDKE 222 >ref|XP_004502849.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Cicer arietinum] Length = 239 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE++ Sbjct: 199 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESS 239 >gb|ACU16940.1| unknown [Glycine max] Length = 240 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE++ Sbjct: 200 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESS 240 >ref|NP_001235066.1| MnSOD [Glycine max] gi|356516259|ref|XP_003526813.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Glycine max] gi|147945633|gb|ABQ52658.1| MnSOD [Glycine max] Length = 241 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE++ Sbjct: 201 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESS 241 >sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|6006619|emb|CAB56851.1| manganese superoxide dismutase 1 [Prunus persica] Length = 228 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKET 122 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE+ Sbjct: 188 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKES 227 >gb|AGI65627.1| Mn-superoxide dismutase, partial [Fragaria x ananassa] Length = 216 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYAS+VY+KE+A Sbjct: 176 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASKVYEKESA 216 >ref|XP_004307727.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Fragaria vesca subsp. vesca] Length = 229 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKETA 125 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYAS+VY+KE+A Sbjct: 189 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASKVYEKESA 229 >gb|AAC15806.1| superoxide dismutase [Raphanus sativus] Length = 231 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKE 119 IDVWEHAYYLQYKNVRPDYLK+VWKVINWKYASEVY+KE Sbjct: 191 IDVWEHAYYLQYKNVRPDYLKNVWKVINWKYASEVYEKE 229 >gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus persica] Length = 237 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKET 122 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE+ Sbjct: 197 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKES 236 >gb|AEZ56249.1| manganese superoxide dismutase [Prunus persica] gi|383386091|gb|AFH08809.1| chloroplast Mn-superoxide dismutase 1A-a [Prunus persica] gi|383386093|gb|AFH08810.1| chloroplast Mn-superoxide dismutase 1A-b [Prunus persica] gi|383386097|gb|AFH08812.1| chloroplast Mn-superoxide dismutase 1A-d [Prunus persica] gi|383386099|gb|AFH08813.1| chloroplast Mn-superoxide dismutase 1B-a [Prunus persica] gi|383386101|gb|AFH08814.1| chloroplast Mn-superoxide dismutase 1B-b [Prunus persica] gi|383386105|gb|AFH08816.1| chloroplast Mn-superoxide dismutase 1B-c [Prunus persica] gi|383386107|gb|AFH08817.1| chloroplast Mn-superoxide dismutase 1B-d [Prunus persica] gi|462414759|gb|EMJ19496.1| hypothetical protein PRUPE_ppa010748mg [Prunus persica] Length = 237 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKET 122 IDVWEHAYYLQYKNVRPDYLK++WKVINWKYASEVY+KE+ Sbjct: 197 IDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKES 236 >ref|XP_006407489.1| hypothetical protein EUTSA_v10021449mg [Eutrema salsugineum] gi|148515008|gb|ABQ81865.1| Mn superoxide dismutase [Eutrema halophilum] gi|557108635|gb|ESQ48942.1| hypothetical protein EUTSA_v10021449mg [Eutrema salsugineum] Length = 231 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKE 119 IDVWEHAYYLQYKNVRPDYLK+VWKVINWKYASEVY+KE Sbjct: 191 IDVWEHAYYLQYKNVRPDYLKNVWKVINWKYASEVYEKE 229 >gb|ABL75952.1| putative Mn superoxide dismutase [Eutrema halophilum] Length = 231 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 IDVWEHAYYLQYKNVRPDYLKSVWKVINWKYASEVYDKE 119 IDVWEHAYYLQYKNVRPDYLK+VWKVINWKYASEVY+KE Sbjct: 191 IDVWEHAYYLQYKNVRPDYLKNVWKVINWKYASEVYEKE 229