BLASTX nr result
ID: Zingiber23_contig00003622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003622 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272606.1| PREDICTED: probable phospholipid hydroperoxi... 56 6e-06 gb|AGT80153.1| glutathione peroxidase [Ipomoea trifida] 55 1e-05 >ref|XP_002272606.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial isoform 1 [Vitis vinifera] gi|359474218|ref|XP_003631418.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial isoform 2 [Vitis vinifera] gi|297742530|emb|CBI34679.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 400 VNKDGKVIDRYAPITSPLSIEKDIKKLLEVS 308 V+KDGKV+DRYAP TSPLSIEKDIKKLL +S Sbjct: 138 VDKDGKVVDRYAPTTSPLSIEKDIKKLLGIS 168 >gb|AGT80153.1| glutathione peroxidase [Ipomoea trifida] Length = 169 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 400 VNKDGKVIDRYAPITSPLSIEKDIKKLLEVS 308 V+KDGKV+DRYAP TSPLSIEKDIKKL+ +S Sbjct: 139 VDKDGKVVDRYAPTTSPLSIEKDIKKLMGIS 169