BLASTX nr result
ID: Zingiber23_contig00003587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003587 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS55038.1| U-box domain-containing protein 4 [Triticum urartu] 68 1e-09 ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4... 67 2e-09 ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4... 67 2e-09 ref|XP_006426022.1| hypothetical protein CICLE_v10024899mg [Citr... 67 2e-09 gb|EOX91593.1| RING/U-box superfamily protein with ARM repeat do... 67 2e-09 dbj|BAK03073.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 4e-09 dbj|BAJ93866.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 4e-09 ref|XP_006404783.1| hypothetical protein EUTSA_v10000047mg [Eutr... 66 6e-09 ref|XP_006380667.1| hypothetical protein POPTR_0007s10280g [Popu... 66 6e-09 ref|XP_006293682.1| hypothetical protein CARUB_v10022640mg [Caps... 66 6e-09 ref|XP_002880484.1| armadillo/beta-catenin repeat family protein... 66 6e-09 ref|NP_179895.6| RING/U-box domain and ARM repeat-containing pro... 66 6e-09 ref|NP_001189583.1| RING/U-box domain and ARM repeat-containing ... 66 6e-09 ref|XP_002332232.1| predicted protein [Populus trichocarpa] 66 6e-09 ref|XP_006659047.1| PREDICTED: U-box domain-containing protein 4... 65 7e-09 ref|XP_002306495.2| hypothetical protein POPTR_0005s18820g [Popu... 65 7e-09 ref|XP_004972465.1| PREDICTED: U-box domain-containing protein 4... 65 7e-09 gb|EMT16948.1| U-box domain-containing protein 4 [Aegilops tausc... 65 7e-09 gb|EMS61710.1| U-box domain-containing protein 4 [Triticum urartu] 65 7e-09 ref|NP_001060820.1| Os08g0110500 [Oryza sativa Japonica Group] g... 65 7e-09 >gb|EMS55038.1| U-box domain-containing protein 4 [Triticum urartu] Length = 440 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+GRR Sbjct: 403 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSGRR 440 >ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4-like isoform X5 [Citrus sinensis] gi|568824264|ref|XP_006466522.1| PREDICTED: U-box domain-containing protein 4-like isoform X6 [Citrus sinensis] Length = 828 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQALLSYFR+QR GNAGR Sbjct: 791 AVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGR 827 >ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Citrus sinensis] gi|568824256|ref|XP_006466518.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Citrus sinensis] gi|568824258|ref|XP_006466519.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 [Citrus sinensis] gi|568824260|ref|XP_006466520.1| PREDICTED: U-box domain-containing protein 4-like isoform X4 [Citrus sinensis] Length = 834 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQALLSYFR+QR GNAGR Sbjct: 797 AVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGR 833 >ref|XP_006426022.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] gi|567866801|ref|XP_006426023.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] gi|567866803|ref|XP_006426024.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] gi|557528012|gb|ESR39262.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] gi|557528013|gb|ESR39263.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] gi|557528014|gb|ESR39264.1| hypothetical protein CICLE_v10024899mg [Citrus clementina] Length = 828 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQALLSYFR+QR GNAGR Sbjct: 791 AVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGR 827 >gb|EOX91593.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508699698|gb|EOX91594.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao] gi|508699699|gb|EOX91595.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508699700|gb|EOX91596.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] Length = 834 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQALLSYFR+QR GNAGR Sbjct: 797 AVPPLVALSQSGTPRAKEKAQALLSYFRTQRHGNAGR 833 >dbj|BAK03073.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 443 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQ LLSYFRSQR GN+GRR Sbjct: 406 AVPPLVALSQSGTPRAREKAQVLLSYFRSQRHGNSGRR 443 >dbj|BAJ93866.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 443 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQ LLSYFRSQR GN+GRR Sbjct: 406 AVPPLVALSQSGTPRAREKAQVLLSYFRSQRHGNSGRR 443 >ref|XP_006404783.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum] gi|557105911|gb|ESQ46236.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum] Length = 826 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRA+EKAQALLSYFR+QR GNAGR Sbjct: 789 AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR 825 >ref|XP_006380667.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa] gi|550334557|gb|ERP58464.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa] Length = 840 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQ+LLSYFR+QR GNAGR Sbjct: 803 AVPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGR 839 >ref|XP_006293682.1| hypothetical protein CARUB_v10022640mg [Capsella rubella] gi|482562390|gb|EOA26580.1| hypothetical protein CARUB_v10022640mg [Capsella rubella] Length = 835 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRA+EKAQALLSYFR+QR GNAGR Sbjct: 798 AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR 834 >ref|XP_002880484.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297326323|gb|EFH56743.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 829 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRA+EKAQALLSYFR+QR GNAGR Sbjct: 792 AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR 828 >ref|NP_179895.6| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|330252323|gb|AEC07417.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Length = 829 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRA+EKAQALLSYFR+QR GNAGR Sbjct: 792 AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR 828 >ref|NP_001189583.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|357529165|sp|O22193.3|PUB4_ARATH RecName: Full=U-box domain-containing protein 4; AltName: Full=Plant U-box protein 4 gi|330252324|gb|AEC07418.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Length = 826 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRA+EKAQALLSYFR+QR GNAGR Sbjct: 789 AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR 825 >ref|XP_002332232.1| predicted protein [Populus trichocarpa] Length = 698 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQ+LLSYFR+QR GNAGR Sbjct: 662 AVPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGR 698 >ref|XP_006659047.1| PREDICTED: U-box domain-containing protein 4-like [Oryza brachyantha] Length = 826 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+ RR Sbjct: 789 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSARR 826 >ref|XP_002306495.2| hypothetical protein POPTR_0005s18820g [Populus trichocarpa] gi|550339266|gb|EEE93491.2| hypothetical protein POPTR_0005s18820g [Populus trichocarpa] Length = 840 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGR 110 AVPPLVALSQSGTPRAKEKAQALLS+FR+QR GNAGR Sbjct: 803 AVPPLVALSQSGTPRAKEKAQALLSFFRNQRHGNAGR 839 >ref|XP_004972465.1| PREDICTED: U-box domain-containing protein 4-like [Setaria italica] Length = 829 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+ RR Sbjct: 792 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSARR 829 >gb|EMT16948.1| U-box domain-containing protein 4 [Aegilops tauschii] Length = 855 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+ RR Sbjct: 818 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSARR 855 >gb|EMS61710.1| U-box domain-containing protein 4 [Triticum urartu] Length = 865 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+ RR Sbjct: 828 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSARR 865 >ref|NP_001060820.1| Os08g0110500 [Oryza sativa Japonica Group] gi|42408388|dbj|BAD09539.1| putative arm repeat-containing protein [Oryza sativa Japonica Group] gi|113622789|dbj|BAF22734.1| Os08g0110500 [Oryza sativa Japonica Group] gi|222639787|gb|EEE67919.1| hypothetical protein OsJ_25785 [Oryza sativa Japonica Group] Length = 824 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +3 Query: 3 AVPPLVALSQSGTPRAKEKAQALLSYFRSQR-GNAGRR 113 AVPPLVALSQSGTPRA+EKAQALLSYFRSQR GN+ RR Sbjct: 787 AVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSARR 824